
alanyl Molecules Structural Archive and Gallery

C11298 N-Formyl-norleucyl-leucyl-phenylalanyl-methylester f-NLP-ME

pdb file: 12760.pdb
sdf file: 12760.sdf
directory: 12760

3,4-Dihydroxy-L-phenylalanyl-AMP 3-Hydroxy-L-tyrosyl-AMP C11462

pdb file: 12920.pdb
sdf file: 12920.sdf
directory: 12920

3,4-Dihydroxy-L-phenylalanyl-[pcp] C11463

pdb file: 12921.pdb
sdf file: 12921.sdf
directory: 12921

5-Chloro-3,4-dihydroxy-L-phenylalanyl-[pcp] C11464

pdb file: 12922.pdb
sdf file: 12922.sdf
directory: 12922

C11606 N-Acetyl-phenylalanyl-norleucyl-arginyl-phenylalanyl-amide NAc-FnorLRF-amide

pdb file: 13053.pdb
sdf file: 13053.sdf
directory: 13053

128595-42-6 Alanylphosphate C12021 D-Alanyl-phosphate

pdb file: 13456.pdb
sdf file: 13456.sdf
directory: 13456

305-84-0 C00386 Carnosine Nalpha-(beta-alanyl)-L-histidine

pdb file: 3621.pdb
sdf file: 3621.sdf
directory: 3621

C00692 UDP-N-acetylmuramoyl-L-alanyl-D-glutamate

pdb file: 3901.pdb
sdf file: 3901.sdf
directory: 3901

C00886 L-Alanyl-tRNA L-Alanyl-tRNA(Ala)

pdb file: 4079.pdb
sdf file: 4079.sdf
directory: 4079

923-16-0 C00993 D-Ala-D-Ala D-Alanyl-D-alanine

pdb file: 4176.pdb
sdf file: 4176.sdf
directory: 4176

584-85-0 Anserine C01262 beta-Alanyl-N(pi)-methyl-L-histidine

pdb file: 4411.pdb
sdf file: 4411.sdf
directory: 4411

402-71-1 C02088 N-Tosyl-L-phenylalanyl chloromethyl ketone TPCK Tos-Phe-CH2Cl

pdb file: 5088.pdb
sdf file: 5088.sdf
directory: 5088

C02335 beta-Alanyl-CoA

pdb file: 5292.pdb
sdf file: 5292.sdf
directory: 5292

(Ac)2-L-Lys-D-Ala-D-Ala (Ac)2-L-lysyl-D-alanyl-D-alanine C03326

pdb file: 6061.pdb
sdf file: 6061.sdf
directory: 6061

C03511 L-Phenylalanyl-tRNA(Phe)

pdb file: 6199.pdb
sdf file: 6199.sdf
directory: 6199

Alanyl-poly(glycerolphosphate) C03999

pdb file: 6572.pdb
sdf file: 6572.sdf
directory: 6572

C04260 O-D-Alanyl-poly(ribitol phosphate)

pdb file: 6769.pdb
sdf file: 6769.sdf
directory: 6769

3-O-L-Alanyl-1-O-phosphatidylglycerol C04372

pdb file: 6855.pdb
sdf file: 6855.sdf
directory: 6855

C04418 N-Acetyl-L-phenylalanyl-L-diiodotyrosine

pdb file: 6887.pdb
sdf file: 6887.sdf
directory: 6887

C04457 D-Alanyl-alanyl-poly(glycerolphosphate)

pdb file: 6919.pdb
sdf file: 6919.sdf
directory: 6919

C04700 UDP-N-acetylmuramoyl-L-alanyl-D-glutamyl-L-lysine UDP-N-acetylmuramoyl-L-alanyl-alpha-D-glutamyl-L-lysine

pdb file: 7107.pdb
sdf file: 7107.sdf
directory: 7107

C04702 UDP-N-acetylmuramoyl-L-alanyl-gamma-D-glutamyl-L-lysyl-D-alanyl-D-alanine UDPMurAc(oyl-L-Ala-D-gamma-Glu-L-Lys-D-Ala-D-Ala)

pdb file: 7108.pdb
sdf file: 7108.sdf
directory: 7108

C04804 UDP-N-acetylmuramoyl-L-Ala-D-gamma-Glu-6-carboxy-L-Lys-D-Ala UDP-N-acetylmuramoyl-L-alanyl-D-gamma-glutamyl-6-carboxy-L-lysyl-D-alanine

pdb file: 7193.pdb
sdf file: 7193.sdf
directory: 7193

C04828 UDP-N-acetylmuramoyl-L-Ala-D-gamma-Glu-6-carboxy-L-Lys-(D-Ala)2 UDP-N-acetylmuramoyl-L-alanyl-D-gamma-glutamyl-6-carboxy-L-lysyl-D-alanyl-D-alanine

pdb file: 7215.pdb
sdf file: 7215.sdf
directory: 7215

C04846 UDP-N-acetylmuramoyl-L-alanyl-D-glutamyl-L-lysyl-D-alanyl-D-alanine

pdb file: 7228.pdb
sdf file: 7228.sdf
directory: 7228

C04851 MurAc(oyl-L-Ala-D-gamma-Glu-L-Lys-D-Ala-D-Ala)-diphospho-undecaprenol Undecaprenyl-diphospho-N-acetylmuramoyl-L-alanyl-gamma-D-glutamyl-L-lysyl-D-alanyl-D-alanine

pdb file: 7233.pdb
sdf file: 7233.sdf
directory: 7233

C04877 UDP-N-acetylmuramoyl-L-alanyl-D-gamma-glutamyl-meso-2,6-diamino-heptanedioate UDP-N-acetylmuramoyl-L-alanyl-D-gamma-glutamyl-meso-2,6-diaminopimelate

pdb file: 7253.pdb
sdf file: 7253.sdf
directory: 7253

C04882 UDP-N-acetylmuramoyl-L-alanyl-D-glutamyl-6-carboxy-L-lysyl-D-alanyl-D-alanine UDP-N-acetylmuramoyl-L-alanyl-D-glutamyl-meso-2,6-diaminopimeloyl-D-alanyl-D-alanine

pdb file: 7257.pdb
sdf file: 7257.sdf
directory: 7257

C04894 UDP-N-acetylmuramoyl-L-alanyl-D-glutamyl-N6-(L-alanyl)-L-lysyl-D-alanyl-D-alanine

pdb file: 7266.pdb
sdf file: 7266.sdf
directory: 7266

C05340 beta-Alanyl-L-arginine

pdb file: 7526.pdb
sdf file: 7526.sdf
directory: 7526

C05341 beta-Alanyl-L-lysine

pdb file: 7527.pdb
sdf file: 7527.sdf
directory: 7527

C05729 R-S-Alanylglycine

pdb file: 7827.pdb
sdf file: 7827.sdf
directory: 7827

C05888 Undecaprenyl-diphospho-N-acetylmuramoyl-L-alanyl-D-glutamyl-L-lysyl-D-alanyl-D-alanine

pdb file: 7956.pdb
sdf file: 7956.sdf
directory: 7956

C05889 Undecaprenyl-diphospho-N-acetylmuramoyl-(N-acetylglucosamine)-L-alanyl-D-glutamyl-L-lysyl-D-alanyl-D-alanine

pdb file: 7957.pdb
sdf file: 7957.sdf
directory: 7957

C05890 Undecaprenyl-diphospho-N-acetylmuramoyl-(N-acetylglucosamine)-L-alanyl-D-glutaminyl-L-lysyl-D-alanyl-D-alanine

pdb file: 7958.pdb
sdf file: 7958.sdf
directory: 7958

C05891 Undecaprenyl-diphospho-N-acetylmuramoyl-(N-acetylglucosamine)-L-alanyl-D-glutaminyl-L-lysyl-(glycyl)5-D-alanyl-D-alanine

pdb file: 7959.pdb
sdf file: 7959.sdf
directory: 7959

C05892 UDP-N-acetylmuramoyl-L-alanyl-gamma-D-glutamyl-L-lysine

pdb file: 7960.pdb
sdf file: 7960.sdf
directory: 7960

C05893 Undecaprenyl-diphospho-N-acetylmuramoyl-(N-acetylglucosamine)-L-alanyl-gamma-D-glutamyl-L-lysyl-D-alanyl-D-alanine

pdb file: 7961.pdb
sdf file: 7961.sdf
directory: 7961

C05894 Undecaprenyl-diphospho-N-acetylmuramoyl-(N-acetylglucosamine)-L-alanyl-D-isoglutaminyl-L-lysyl-D-alanyl-D-alanine

pdb file: 7962.pdb
sdf file: 7962.sdf
directory: 7962

C05895 Undecaprenyl-diphospho-N-acetylmuramoyl-(N-acetylglucosamine)-L-alanyl-D-isoglutaminyl-L-lysyl-(glycyl)5-D-alanyl-D-alanine

pdb file: 7963.pdb
sdf file: 7963.sdf
directory: 7963

C05897 Undecaprenyl-diphospho-N-acetylmuramoyl-L-alanyl-D-glutamyl-meso-2,6-diaminopimeloyl-D-alanyl-D-alanine

pdb file: 7965.pdb
sdf file: 7965.sdf
directory: 7965

C05898 Undecaprenyl-diphospho-N-acetylmuramoyl-(N-acetylglucosamine)-L-alanyl-D-glutamyl-meso-2,6-diaminopimeloyl-D-alanyl-D-alanine

pdb file: 7966.pdb
sdf file: 7966.sdf
directory: 7966

C05899 Undecaprenyl-diphospho-N-acetylmuramoyl-(N-acetylglucosamine)-L-alanyl-D-glutaminyl-meso-2,6-diaminopimeloyl-D-alanyl-D-alanine

pdb file: 7967.pdb
sdf file: 7967.sdf
directory: 7967

C05900 Undecaprenyl-diphospho-N-acetylmuramoyl-(N-acetylglucosamine)-L-alanyl-D-glutaminyl-meso-2,6-diaminopimeloyl-(glycyl)5-D-alanyl-D-alanine

pdb file: 7968.pdb
sdf file: 7968.sdf
directory: 7968

2-Amino-4-(methylphosphino)butyrylalanylalanine 35597-43-4 Bialaphos C06457 gamma-(Hydroxymethylphosphinyl)-L-alpha-aminobutyryl-L-alanyl-L-alanine

pdb file: 8431.pdb
sdf file: 8431.sdf
directory: 8431

83150-76-9 C07306 D-Phenylalanyl-L-cysteinyl-L-phenylalanyl-D-tryptophyl-L-lysyl-L-threonyl-N-((1R,2R)-2-hydroxy-1-(hydroxymethyl)propyl)-L-cysteinamide cyclic (2-

pdb file: 9104.pdb
sdf file: 9104.sdf
directory: 9104

531-77-1 L,L-Asaline L-Valine, N-[N-acetyl-4-[bis(2-chloroethyl)amino]-L-phenyl-alanyl]-, ethyl ester NSC66610 Valine, N-[N-acetyl-3-[p-[bis(2-chloroethyl)amino]phenyl]-L-alanyl]-, ethyl ester, L-

pdb file: 111652.pdb
sdf file: 111652.sdf
directory: 111652

13331-67-4 Alanine, 3-[p-[bis(2-chloroethyl)amino]phenyl]-N-(N-formyl-3-phenyl-L-alanyl-, ethyl ester L- NSC68989

pdb file: 113007.pdb
sdf file: 113007.sdf
directory: 113007

CYSTEINE DERIV L-Cysteine, N-[N-[N-[(phenylmethoxy)carbonyl]-.beta.-alanyl]-S-(phenylmethyl)-L-cysteinyl]-S-(triphenylmethyl)-, methyl ester NSC234762

pdb file: 133724.pdb
sdf file: 133724.sdf
directory: 133724

13758-27-5 B100928K382 L-Valine, N-(2-quinoxalinylcarbonyl)-D-seryl-L-alanyl- N-methyl-L-cysteinyl-N-methyl-, bimol. lactone, cyclic disulfide NSC244425 Triostin A

pdb file: 135764.pdb
sdf file: 135764.sdf
directory: 135764

26049-94-5 Carbamic acid, [.alpha.-(chloroacetyl)phenethyl]-, benzyl ester, L- Carbamic acid, [3-chloro-2-oxo-1-(phenylmethyl)propyl]-, phenylmethyl ester, (S)- L-Carbobenzyloxyphenylalanyl chloromethyl ketone L-[.alpha.-(Chloroacetyl)phenethyl]carbamic acid, benzyl ester N(.alpha.)-Benzyloxycarbonylphenylalanylchloromethane N-(Benzyloxycarbonyl)-L-phenylalanine chloromethyl ketone N-Carbobenzoxy-L-phenylalanyl-chloromethyl ketone N-[(Benzyloxy)carbonyl]-L-phenylalanine chloromethyl ketone NSC251810

pdb file: 137553.pdb
sdf file: 137553.sdf
directory: 137553

26488-24-4 Cyclo(D-phenylalanyl-L-prolyl) Cyclo(L-prolyl-D-phenylalanyl) NSC255998 Pyrrolo[1,2-a]pyrazine-1,4-dione, hexahydro-3-(phenylmethyl)-, (3R-cis)-

pdb file: 138408.pdb
sdf file: 138408.sdf
directory: 138408


pdb file: 141033.pdb
sdf file: 141033.sdf
directory: 141033

(S)-3'-((2-Amino-3-(4-methoxyphenyl)-1-oxopropyl)amino)-3'-deoxy-N,N-dimethyladenosine 3'-(L-alpha-Amino-p-methoxyhydrocinnamamido)-3'-deoxy-N,N-dimethyladenosine 3123L 53-79-2 58-58-2 6-Dimethylamino-9-(3'-(p-methoxy-L-phenylalanylamino)-beta-D-ribofuranosyl)-purine Achromycin Achromycin (purine derivative) Adenosine, 3'-((2-amino-3-(4-methoxyphenyl)-1-oxopropyl)amino)-3'-deoxy-N,N-dimethyl-, (S)- Adenosine, 3'-(alpha-amino-p-methoxyhydrocinnamamido)-3'-deoxy-N,N-dimethyl-, L- CL 13,900 CL 16536 NSC-3055 P-638 PUROMYCIN Puromicina [INN-Spanish] Puromycin [USAN:BAN:INN] Puromycine [INN-French] Puromycinum [INN-Latin] Stillomycin Stylomycin

pdb file: 148693.pdb
sdf file: 148693.sdf
directory: 148693

2-(L-Phenylalanine)-8-L-lysinevasopressin 56-59-7 EINECS 200-282-7 FELYPRESSIN Felipresina [INN-Spanish] Felipressina [DCIT] Felypressin [USAN:BAN:INN] Felypressine [INN-French] Felypressinum [INN-Latin] L-Cysteinyl-L-phenylalanyl-L-phenylalanyl-L-glutaminyl-L-asparaginyl-L-cysteinyl-L-prolyl-L-lysylglycinamide cyclic (1-

pdb file: 148784.pdb
sdf file: 148784.sdf
directory: 148784

5-Oxo-L-prolyl-L-prolyl-L-seryl-L-lysyl-L-aspartyl-L-alanyl-L-phenylalanyl-L-isoleucylglycyl-L-leucyl-L-methioninamide 69-25-0 BRN 4796573 ELD 950 ELEDOISIN Eledoisin

pdb file: 149165.pdb
sdf file: 149165.sdf
directory: 149165

305-84-0 4-25-00-04381 (Beilstein Handbook Reference) 7683-28-5 BRN 0087671 Carnosine EINECS 206-169-9 Ignotine Karnozin Karnozzn L-Carnosine L-HISTIDINE, N-beta-ALANYL- L-Histidine, beta-alanyl- N-2-M NSC 524045 beta-Alanyl-L-histidine

pdb file: 152576.pdb
sdf file: 152576.sdf
directory: 152576

130021-38-4 402-71-1 BRN 2895215 Benzenesulfonamide, N-((1S)-3-chloro-2-oxo-1-(phenylmethyl)propyl)-4-methyl- Benzenesulfonamide, N-(3-chloro-2-oxo-1-(phenylmethyl)propyl)-4-methyl-, (S)- EINECS 206-954-6 L-1-Tosylamido-2-phenylethyl chloromethyl ketone L-Chloromethyl (2-phenyl-1-(p-toluenesulphonylamino)ethyl) ketone N-Tosyl-L-phenylalanine chloromethyl ketone TOSYLPHENYLALANYL CHLOROMETHYL KETONE l-N-(alpha-(Chloroacetyl)phenethyl)-p-toluenesulfonamide p-Toluenesulfonamide, N-(alpha-(chloroacetyl)phenethyl)-, (-)-

pdb file: 153043.pdb
sdf file: 153043.sdf
directory: 153043

584-85-0 ANSERINE EINECS 209-545-0 L-Anserine L-Histidine, N-beta-alanyl-3-methyl- N-beta-Alanyl-3-methyl-L-histidine

pdb file: 154748.pdb
sdf file: 154748.sdf
directory: 154748

1045-82-5 10H-Phenothiazine, 2-chloro-10-(3-(diethylamino)-1-oxopropyl)- (9CI) 2-Chloro-10-(3-diethylaminopropionyl)phenothiazine 2-Chloro-10-(N,N-diethyl-beta-alanyl)phenothiazine 4-27-00-01315 (Beilstein Handbook Reference) 800-22-6 BRN 0042353 CHLORACYZINE Chloracizin Chloracizine Chloracizinum Chloracyzine [DCF:INN] Chloracyzinum [INN-Latin] Chlorazicin Chlorazicine Chloroacizin Chloroacizine Chloroacyzin Cloracizina [INN-Spanish] G-020 Phenothiazine, 2-chloro-10-(N,N-diethyl-beta-alanyl)-

pdb file: 156465.pdb
sdf file: 156465.sdf
directory: 156465

1687-81-6 3-(N,N-Dimethylalanyl)-1,8,8-trimethyl-3-azabicyclo(3.2.1)octane 3-AZABICYCLO(3.2.1)OCTANE, 3-(N,N-DIMETHYLALANYL)-1,8,8-TRIMETHYL- BRN 1345894 N-(2-Dimethylaminopropionyl)camphidine

pdb file: 158836.pdb
sdf file: 158836.sdf
directory: 158836

15686-70-1 5118-28-5 5534-95-2 7488-96-2 77055-37-9 AY 6608 Alaninamide, N-carboxy-beta-alanyl-L-tryptophyl-L-methionyl-L-aspartylphenyl-, N-tert-butyl ester, L- Alaninamide, N-carboxy-beta-alanyl-L-tryptophyl-L-methionyl-L-aspartylphenyl-, N-tert-butylester, L- BRN 5472892 Boc-beta-ala-try-met-asp-phe(nh2) EINECS 226-889-7 Gastrodiagnost HSDB 3247 ICI 50123 L-Phenylalaninamide, N-((1,1-dimethylethoxy)carbonyl)-beta-alanyl-L-tryptophyl-L-methionyl-L-alpha-aspartyl- N-(N-(N-(N-(N-tert-Butoxycarbonyl-beta-alanyl)-L-tryptophanyl)-L-methionyl)-L-aspartyl)-L-phenylalaninamide N-(alpha-Carbamoylphenethyl)-3-(2-(2-(3-(carboxyamino)propionamido)-3-indol-3-ylpropionamido)-4-(methylthio)butyramido)succinamic acid N-tert-butyl ester N-Carboxy-beta-alanyl-L-tryptophyl-L-methionyl-L-aspartylphenyl-L-alaninamide N-tert-butyl ester N-t-Butyloxycarbonyl-beta-alanyl-L-tryptophyl-L-methion yl-L-aspartyl-L-phenylalanine amide NSC 367746 PENTAGASTRIN Pentagastrin [USAN:BAN:INN:JAN] Pentagastrina [INN-Spanish] Pentagastrine [INN-French] Pentagastrinum [INN-Latin] Peptavlon Petogasrin

pdb file: 164419.pdb
sdf file: 164419.sdf
directory: 164419

10065-57-3 3733-45-7 ALANINE, N-(N-ACETYL-3-(p-(BIS(2-CHLOROETHYL)AMINO)PHENYL)ALANYL)-3-PHENYL-, ETH Alanine, N-(N-acetyl-3-(p-(bis(2-chloroethyl)amino)phenyl)alanyl)-3-phenyl-, ethyl ester Asafan Asaphan Ethyl ester of N-acetyl-DL-sarcolysyl-L-phenylalanine L-Phenylalanine, N-(N-acetyl-4-(bis(2-chloroethyl)amino)-L-phenylalanyl)-, ethyl ester (9CI)

pdb file: 167680.pdb
sdf file: 167680.sdf
directory: 167680

11061-68-0 A protein that has the normal structure of the natural antidiabetic principle produced by the human pancreas EINECS 234-279-7 HUMAN INSULIN Humulin Humulin R Humuline Insulin Insulin (Cercopithecus aethiops) Insulin (Macaca fascicularis) Insulin (Macaca mulatta) Insulin (Pan troglodytes) Insulin (human) Insulin (ox), 8A-L-threonine-10A-L-isoleucine-30B-L-threonine- Insulin human Insulin human (synthesis) Insulin human [USAN:BAN:INN] Insulin, human synthetic Insulina humana [Spanish] Insuline humaine [French] Insulinum humanum [Latin] L-Threonine, L-phenylalanyl-L-valyl-L-asparaginyl-L-glutaminyl-L-histidyl-L-leucyl-L-cysteinylglycyl-L-seryl-L-histidyl-L-leucyl-L-valyl-L-alpha-glutamyl-L-alanyl-L-leucyl-L-tyrosyl-L-leucyl-L-valyl-L-cysteinylglycyl-L-alpha-glutamyl-L-arginylglycyl-L-phenylalanyl-L-phenylalanyl-L-tyrosyl-L-threonyl-L-prolyl-L-lysyl-, cyclic (7-7'),(19-20')-bis(disulfide) with glycyl-L-isoleucyl-L-valyl-L-alpha-glutamyl-L-glutaminyl-L-cysteinyl-L-cysteinyl-L-threonyl-L-seryl-L-isoleucyl-L-cysteinyl-L-seryl-L-leucyl-L-tyrosyl-L-glutaminyl-L-leucyl-L-alpha-glutamyl-L-asparaginyl-L_tyrosyl-L-cysteinyl-L-asparagine cyclic (6'-11')-disulfide Novolin R Penfil R Ultraphane

pdb file: 168202.pdb
sdf file: 168202.sdf
directory: 168202

12663-46-6 1339-68-0 52248-87-0 CCRIS 1316 CYCLOCHLOROTINE Chlorine-containing peptide, from penicillium islandicum Chloropeptide Chloropeptide, from penicillium islandicum Cyclic(L-3-phenyl-beta-alanyl-L-seryl-(3S-cis)-3,4-dichloro-L-prolyl-L-alpha-aminobutyryl-L-seryl) Cyclic(L-3-phenyl-beta-alanyl-L-seryl-3,4-dichloro-L-prolyl-L-alpha-aminobutyryl-L-seryl) HSDB 3478 Islanditoxin

pdb file: 168347.pdb
sdf file: 168347.sdf
directory: 168347

14329-69-2 2-NAPHTHYLAMINE, N-(L-ALANYL)-1,2,3,4-TETRAHYDRO- L-Alanyl-tetrahydro-beta-naphthylamin [German] Propionamide, 2-amino-N-(1,2,3,4-tetrahydro-2-naphthyl)-, hydrobromide (7CI) Propionamide, 2-amino-N-(1,2,3,4-tetrahydro-2-naphthyl)-, monohydrobromide (8CI) Propionamide, alpha-amino-N-(2-(1,2,3,4-tetrahydronaphthyl))- RG 305 Richter Tedranalin

pdb file: 169339.pdb
sdf file: 169339.sdf
directory: 169339

(1-24)alpha-ACTH 16960-16-0 17008-05-8 35-33-6 37341-02-9 52051-40-8 ACTHalpha1-24 Acth 1-24 Acth(sup 1-24) Acth-Z Acthalpha(1-24) Actholain Adrenocorticotropic hormone 1-24 BRN 0940671 Ba 30920 Ba 36716 COSYNTROPIN Corticotropin-(1-24) Cortrophin S Cortrosinta Cortrosyn Cosyntropin [USAN] EINECS 241-031-1 HSDB 3307 L-Seryl-L-tyrosyl-L-seryl-L-methionyl-L-glutamyl-L-histidyl-L-phenylalanyl-L-arginyl-L-tryptophylglycyl-L-lysyl-L-prolyl-L-valylglycyl-L-lysyl-L-lysyl-L-arginyl-L-arginyl-L-prolyl-L-valyl-L-lysyl-L-valyl-L-tyrosyl-L-proline Nuvacthen depot Porcine ACTH (1-24) Synacthen Synacthene-retard Tetracosactid Tetracosactida [INN-Spanish] Tetracosactide Tetracosactidum [INN-Latin] Tetracosactrin Tetracosapeptide alpha(sup 1-24)-Acth alpha(sup 1-24)-Corticotropin alpha1-24-Corticotropin beta(1-24)-Tetracosactide beta(sup 1-24)-Corticotropin beta(sup 1-24)-Tetracosactide beta-1,24-Corticotrophin beta-Corticotrophin-(1-24)-tetracosapeptide

pdb file: 170660.pdb
sdf file: 170660.sdf
directory: 170660

11031-05-3 17466-45-4 63-24-1 BRN 4347460 Cyclic(L-alanyl-D-threonyl-L-cysteinyl-cis-4-hydroxy-L-prolyl-L-alanyl-2-mercapto-L-tryptophyl-4,5-dihydroxy-L-leucyl), cyclic (3,6)-sulfide EINECS 241-484-5 HSDB 3524 NSC 523214 PHALLOIDIN Phalloidine

pdb file: 171011.pdb
sdf file: 171011.sdf
directory: 171011

11030-50-5 20449-79-0 Bee venom melittin Forapin Forapine Honeybee melittin L-Glutamamide, glycyl-L-isoleucylglycyl-L-alanyl-L-valyl-L-leucyl-L-lysyl-L-valyl-L-leucyl-L-threonyl-L-threonylglycyl-L-leucyl-L-prolyl-L-alanyl-L-Leucyl-L-isoleucyl-L-seryl-L-tryptophyl-L-isoleucyl-L-lysyl-L-arginyl-L-lysyl-L-arginyl-L-glutaminyl- Melitten Melittin Melittin (apis cerana) Melittin (honeybee) Melittin (major) (8CI) Melittin I

pdb file: 172336.pdb
sdf file: 172336.sdf
directory: 172336

22048-48-2 3,3-Dimethyl-1-(3-(dimethylamino)propyl)-1-phthalanyl methyl ketone hydrochloride KETONE, 3,3-DIMETHYL-1-(3-(DIMETHYLAMINO)PROPYL)-1-PHTHALANYL METHYL, HYDROCHLOR Ketone, 3,3-dimethyl-1-(3-(dimethylamino)propyl)-1-phthalanyl methyl, hydrochloride LU 3-102 hydrochloride

pdb file: 172972.pdb
sdf file: 172972.sdf
directory: 172972

1-(3,3-Dimethyl-3-(dimethylamino)propyl)-1-phthalanyl phenyl ketone hydrochloride 22048-50-6 KETONE, 1-(3,3-DIMETHYL-3-(DIMETHYLAMINO)PROPYL)-1-PHTHALANYL PHENYL, HYDROCHLOR Ketone, 1-(3,3-dimethyl-3-(dimethylamino)propyl)-1-phthalanyl phenyl, hydrochloride LU 3-105 hydrochloride

pdb file: 172973.pdb
sdf file: 172973.sdf
directory: 172973

22048-55-1 3,3-Dimethyl-1-(3-(methylamino)propyl)-1-phthalanyl methyl ketone hydrochloride KETONE, 3,3-DIMETHYL-1-(3-(METHYLAMINO)PROPYL)-1-PHTHALANYL METHYL, HYDROCHLORID Ketone, 3,3-dimethyl-1-(3-(methylamino)propyl)-1-phthalanyl methyl, hydrochloride LU 4-003 hydrochloride

pdb file: 172974.pdb
sdf file: 172974.sdf
directory: 172974

(E)-6-(4-Hydroxy-6-methoxy-7-methyl-3-oxo-5-phthalanyl)-4-methyl-4-hexenoic acid 24280-93-1 4-Hexenoic acid, 6-(1,3-dihydro-4-hydroxy-6-methoxy-7-methyl-3-oxo-5-isobenzofuranyl)-4-methyl-, (E)- 4-Hexenoic acid, 6-(4-hydroxy-6-methoxy-7-methyl-3-oxo-5-phthalanyl)-4-methyl-, (E)- 4-Methyl-5-methoxy-7-hydroxy-6-(5-carboxy-3-methylpent-2-en-1-yl)-phthalide (E)- 6-(4-Hydroxy-6-methoxy-7-methyl-3-oxo-5-phthalanyl)-4-methyl-4-hexenoic acid (E)- Acide mycophenolique [INN-French] Acido micofenolico [INN-Spanish] Acidum mycophenolicum [INN-Latin] CCRIS 5565 EINECS 246-119-3 Lilly-68618 Ly 68618 MYCOPHENOLIC ACID, (E)- Melbex Micofenolico acido [Spanish] Mycophenolic acid Mycophenolic acid [USAN:BAN:INN] Mycophenolsaeure Myfortic NSC 129185 NSC-129185

pdb file: 174249.pdb
sdf file: 174249.sdf
directory: 174249

11049-84-6 16812-94-5 24345-16-2 28883-82-1 30797-89-8 Apamin Apamin (reduced) cyclic (1-11),(3-15)-bis(disulfide) Apamine EINECS 246-182-7 L-Histidinamide, L-cysteinyl-L-asparaginyl-L-cysteinyl-L-lysyl-L-alanyl-L-prolyl-L-alpha-glutamyl-L-threonyl-L-alanyl-L-leucyl-L-cysteinyl-L-alanyl-L-arginyl-L-arginyl-L-cysteinyl-L-glutaminyl-L-glutaminyl-, cyclic (1-11)(3-15)-bis(disulfide) Ro 23-6721

pdb file: 174290.pdb
sdf file: 174290.sdf
directory: 174290

(E)-L-N-(3-(3-Carbamoylacrylamido)alanyl)alanine 36051-75-9 A-19009 ALANINE, N-(3-(3-CARBAMOYLACRYLAMIDO)ALANYL)-, (E)-L- Antibiotic A-19009 Fumarylcarboxamido-L-2,3-diaminopropionyl-L-alanine

pdb file: 178734.pdb
sdf file: 178734.sdf
directory: 178734

(R)-2-Amino-4-((2-aminopropionyl)amino)-2,4-dideoxy-L-arabinose 38819-28-2 4-N-D-Alanyl-2,4-diamino-2,4-dideoxy-L-arabinose EINECS 254-134-1 L-ARABINOSE, 2-AMINO-4-((2-AMINO-1-OXOPROPYL)AMINO)-2,4-DIDEOXY-, (R)- Prumycin

pdb file: 179359.pdb
sdf file: 179359.sdf
directory: 179359

39978-20-6 ALANINE, N-(2-FURANYLCARBONYL)-, (3-(5-NITRO-2-FURANYL)-2-PROPENYLIDENE)HYDRAZID Alanine, N-(2-furanylcarbonyl)-, (3-(5-nitro-2-furanyl)-2-propenylidene)hydrazide, DL- BRN 1331823 N(sup 1)-(N'-2'-Furoyl (+-) alanyl)-N(sup 2)-(5''-nitro-2''-furyl-acrylidene)-hydrazine N-(2-Furanylcarbonyl)-DL-alanine (3-(5-nitro-2-furanyl)-2-propenylidene)hydrazide

pdb file: 179608.pdb
sdf file: 179608.sdf
directory: 179608

2',6'-Propionoxylidide, 2-amino- 2-AMINO-N-(2,6-DIMETHYLPHENYL)PROPANAMIDE 2-Amino-2',6'-propionoxylidide 2-Amino-N-(2,6-dimethylphenyl)propionamid 35891-93-1 41708-72-9 Alanyl-2,6-xylidide Astra W 36095 BRN 2416564 EINECS 255-505-0 Propanamide, 2-amino-N-(2,6-dimethylphenyl)- Tocainida [INN-Spanish] Tocainide Tocainide [USAN:BAN:INN] Tocainidum [INN-Latin]

pdb file: 180066.pdb
sdf file: 180066.sdf
directory: 180066

3-beta,14-Dihydroxy-5-beta-card-20(22)-enolide 3-ester with L-alanine 42716-81-4 5-beta-CARD-20(22)-ENOLIDE, 3-beta,14-DIHYDROXY-, 3-(2-AMINOPROPIONATE) (ester), 5-beta-Card-20(22)-enolide, 3-beta,14-dihydroxy-, 3-(2-aminopropionate) (ester), L- Digitoxigenin-3-beta-L-alanyl ester

pdb file: 180287.pdb
sdf file: 180287.sdf
directory: 180287

53678-77-6 Acetylmuramyl-alanyl-isoglutamine BRN 4220745 D-alpha-Glutamine, N(sup 2)-(N-(N-acetylmuramoyl)-L-alanyl)- D-alpha-Glutamine, N2-(N-(N-acetylmuramoyl)-L-alanyl)- EINECS 258-696-9 Muramyl Dipeptide N(sup 2)-(N-(N-Acetylmuramoyl)-L-alanyl)-D-alpha-glutamine N2-(N-(N-Acetylmuramoyl)-L-alanyl)-D-alpha-glutamine

pdb file: 181651.pdb
sdf file: 181651.sdf
directory: 181651

1-5-Adrenorphin (human) 58569-55-4 Adrenorphin (human), 6-de-L-arginine-7-de-L-arginine-8-de-L-valinamide- CCRIS 4225 EINECS 261-335-8 ENKEPHALIN, METHIONINE Lupex MET-enkephalin Methionine enkephalin N-(N-(N-(N-L-Tyrosylglycyl)glycyl)-L-phenylalanyl)-L-methionine NSC 374896 Opioid growth factor Porcine beta-endorphin 1-5 Tyr-Gly-Gly-Phe-Met-OH

pdb file: 183270.pdb
sdf file: 183270.sdf
directory: 183270

58822-25-6 CCRIS 6338 EINECS 261-457-1 ENKEPHALIN, LEUCINE L-Leucine, N-(N-(N-(N-L-tyrosylglycyl)glycyl)-L-phenylalanyl)- Leu-enkephalin Leucine enkephalin Leucine-enkephalin N-(N-(N-(N-L-Tyrosylglycyl)glycyl)-L-phenylalanyl)-L-leucine NSC 350588

pdb file: 183330.pdb
sdf file: 183330.sdf
directory: 183330

(R-(R*,R*-(E)))-Cyclic(L-alanyl-D-alanyl-N-methyl-L-leucyl-N-methyl-L-leucyl-N-methyl-L-valyl-3-hydroxy-N,4-dimethyl-L-2-amino-6-octenoyl-L-alpha-aminobutyryl-N-methylglycyl-N-methyl-L-leucyl-L-valyl-N-methyl-L-leucyl) 104250-72-8 55126-45-9 56645-58-0 59865-13-3 Antibiotic S 7481F1 CCRIS 1590 CYCLOSPORIN A Ciclosporin Ciclosporina [INN-Spanish] Ciclosporine [INN-French] Ciclosporinum [INN-Latin] Cipol N Consupren Cyclo(L-alanyl-D-alanyl-N-methyl-L-leucyl-N-methyl-L-leucyl-N-methyl-L-valyl-((3R,4R,6E)-6,7-didehydro-3-hydroxy-N,4-dimethyl-L-2-aminooctanoyl-L-2-aminobutanoyl-N-methylglycyl-N-methyl-L-leucyl-L-valyl-N-methylleucyl) Cyclosporin Cyclosporine Cyclosporine A Cyclosporine [USAN] DRG-0275 HSDB 6881 NSC 290193 Neoplanta Neoral OL 27-400 Ramihyphin A Restasis S 7481F1 S-Neoral Sandimmun Sandimmun Neoral Sandimmune Sang 35

pdb file: 183554.pdb
sdf file: 183554.sdf
directory: 183554

3,4-Diacetyloxy-L-phenylalanyl-3,4-diacetyloxy-L-phenylalanine methyl ester hydrochloride 59866-16-9 ALANINE, N-(3,4-DIACETOXY-L-PHENYLALANYL)-3-(3,4-DIACETOXYPHENYL)-, METHYL ESTER Alanine, N-(3,4-diacetoxy-L-phenylalanyl)-3-(3,4-diacetoxyphenyl)-, methyl ester, hydrochloride, L-

pdb file: 183555.pdb
sdf file: 183555.sdf
directory: 183555

(D-Ala2,D-Leu5)enkephalin 2-Alanyl-leucine enkephalin 5-Leucine-2-alanine enkephalin 63631-40-3 D-Leucine, N-(N-(N-(N-L-tyrosyl-D-alanyl)glycyl)-L-phenylalanyl)- ENKEPHALIN, LEUCINE-2-ALANINE Enkephalin-leu,ala(2) Leucine enkephalin-2-alanine

pdb file: 184754.pdb
sdf file: 184754.sdf
directory: 184754

63968-82-1 KASSININ L-Methioninamide, L-alpha-aspartyl-L-valyl-L-prolyl-L-lysyl-L-seryl-L-alpha-aspartyl-L-glutaminyl-L-phenylalanyl-L-valylglycyl-L-leucyl- L-alpha-Aspartyl-L-valyl-L-prolyl-L-lysyl-L-seryl-L-alpha-aspartyl-L-glutaminyl-L-phenylalanyl-L-valylglycyl-L-leucyl-L-methioninamide

pdb file: 185565.pdb
sdf file: 185565.sdf
directory: 185565

(D-Ala2,MePhe4,Met5(O))enkephalinol (D-Ala2,N-methyl-Phe4,Met-(O)5-ol)enkepyhalin 115814-36-3 64854-64-4 71387-98-9 71640-46-5 72724-43-7 81031-36-9 BRN 3079169 D-Ala2,MePhe4,Met5(O))enkephalinol Damme FK 33-8224 FK 33-824 L-Phenylalaninamide, L-tyrosyl-D-alanylglycyl-N-(1-(hydroxymethyl)-3-(methylsulfinyl)propyl)-N(sup alpha)-methyl-, (1S)- L-Phenylalaninamide, L-tyrosyl-D-alanylglycyl-N-(1-(hydroxymethyl)-3-(methylsulfinyl)propyl)-nalpha-methyl-, (1S)- SAN 33-824 Sandoz 33-824 Sandoz FK 33-824

pdb file: 186751.pdb
sdf file: 186751.sdf
directory: 186751

2-Acetamido-3-O-((R)-1-(((S)-1-(((R)-3-carbamoyl-1-carboxypropyl)carbamoyl)ethyl)carbamoyl)ethyl)-2-deoxy-D-glucopyranose, butyl ester 74817-61-1 Butyl N2-((2S)-2-((2R)-2-(2-acetamido-2-desoxy-D-3-glucopyranosyloxy)propionamido)propionyl)-D-glutaminat D-Glutamine, N2-(N-(N-acetylmuramoyl)-L-alanyl)-, butyl ester MURABUTIDE Murabutida [Spanish] Murabutide [INN] Murabutidum [Latin] N-Acetylmuramyl-alanylglutamine-n-butyl ester

pdb file: 191011.pdb
sdf file: 191011.sdf
directory: 191011

(S)-1-(N-(1-(Ethoxycarbonyl)-3-phenylpropyl)-L-alanyl)-L-proline 1-(N-((S)-1-Carboxy-3-phenylpropyl)-L-alanyl)-L-proline 1'-ethyl ester 172964-46-4 75847-73-3 76095-16-4 77549-58-7 Bonuten ENALAPRIL Enalapril Richet Enalaprila [INN-Spanish] Enalaprilum [INN-Latin] Gadopril Kinfil L-Proline, 1-(N-(1-(ethoxycarbonyl)-3-phenylpropyl)-L-alanyl)-, (S)- L-Proline, N-((1S)-1-(ethoxycarbonyl)-3-phenylpropyl)-L-alanyl-

pdb file: 191211.pdb
sdf file: 191211.sdf
directory: 191211

76420-72-9 84680-54-6 EINECS 278-459-3 Enalapril acid Enalapril diacid Enalaprilat Enalaprilat anhydrous Enalaprilate [French] Enalaprilatum [Latin] Enalaprilic acid L-Proline, 1-(N-(1-carboxt-3-phenylpropyl)-L-alanyl)-, (S)- L-Proline, N-((1S)-1-carboxy-3-phenylpropyl)-L-alanyl- MK 421 diacid MK 422 N-(1(S)-Carboxy-3-phenylpropyl)-L-alanyl-L-proline enalaprilat [Spanish]

pdb file: 191322.pdb
sdf file: 191322.sdf
directory: 191322

79517-01-4 83150-76-9 D-Phenylalanyl-L-cysteinyl-L-phenylalanyl-D-tryptophyl-L-lysyl-L-threonyl-N-((1R,2R)-2-hydroxy-1-(hydroxymethyl)propyl)-L-cysteinamide cyclic (2-

pdb file: 191981.pdb
sdf file: 191981.sdf
directory: 191981

(2S,3aS,7aS)-1-((S)-N-((S)-1-Carboxy-3-phenylpropyl)alanyl)hexahydro-2-indolinecarboxylic acid, 1-ethyl ester, monohydrochloride 1H-INDOLE-2-CARBOXYLIC ACID, OCTAHYDRO-1-(2-((1-(ETHOXYCARBONYL)-3-PHENYLPROPYL) 1H-Indole-2-carboxylic acid, 1-(2-((1-(ethoxycarbonyl)-3-phenylpropyl)amino)-1-oxopropyl)octahydro-, monohydrochloride, (2S-(1(R*(R*)),2alpha,3abeta,7abeta))- 1H-Indole-2-carboxylic acid, octahydro-1-(2-((1-(ethoxycarbonyl)-3-phenylpropyl)amino)-1-oxypropyl)-, monohydrochloride, (2S-(1(R*(R*)),2-alpha,3-alpha-beta,7-alpha-beta))- 80828-32-6 CI 907 Indolapril hydrochloride Indolapril hydrochloride [USAN] Sch 31846 hydrochloride

pdb file: 192193.pdb
sdf file: 192193.sdf
directory: 192193

(2S,3aS,7aS)-1-((S)-N-((S)-1-Carboxy-3-phenylpropyl)alanyl)hexahydro-2-indolinecarobxylic acid 1-ethyl ester (2S,3aS,7aS)-1-(N-((S)-1-Ethoxycarbonyl-3-phenylpropyl)-L-alanyl)-2-hexahydroindolinecarbonsaeure 1H-INDOLE-2-CARBOXYLIC ACID, OCTAHYDRO-1-(2-((1-(ETHOXYCARBONYL)-3-PHENYLPROPYL) 1H-Indole-2-carboxylic acid, octahydro-1-(2-((1-(ethoxycarbonyl)-3-phenylpropyl)amino)-1-oxopropyl)-, (2S-(1(R*(R*)),2-alpha,3a-beta,7a-beta))- 80876-01-3 Indolapril Indolaprilum [Latin] Sch 31846

pdb file: 192199.pdb
sdf file: 192199.sdf
directory: 192199

3-beta,14-Dihydroxy-5-beta-card-20(22)-enolide 3-ester with D-2-aminobutyric acid 5-beta-CARD-20(22)-ENOLIDE, 3-beta,14-DIHYDROXY-, 3-(2-AMINOBUTYRATE) (ester), D 5-beta-Card-20(22)-enolide, 3-beta,14-dihydroxy-, 3-(2-aminobutyrate) (ester), D- 81072-19-7 Digitoxigenin-3-beta-(3-methyl-D-alanyl) ester

pdb file: 192209.pdb
sdf file: 192209.sdf
directory: 192209

3-beta,14-Dihydroxy-5-beta-card-20(22)-enolide 3-ester with-L-2-aminobutyric acid 5-beta-CARD-20(22)-ENOLIDE, 3-beta,14-DIHYDROXY-, 3-(2-AMINOBUTYRATE) (ester), L 5-beta-Card-20(22)-enolide, 3-beta,14-dihydroxy-, 3-(2-aminobutyrate) (ester), L- 81072-20-0 Digitoxingenin-3-beta-(3-methyl-L-alanyl) ester

pdb file: 192210.pdb
sdf file: 192210.sdf
directory: 192210

3-beta,14-Dihydroxy-5-beta-card-20(22)-enolide 3-ester with D-alanine 5-beta-CARD-20(22)-ENOLIDE, 3-beta,14-DIHYDROXY-, 3-(2-AMINOPROPIONATE) (ester), 5-beta-Card-20(22)-enolide, 3-beta,14-dihydroxy-, 3-(2-aminopropionate) (ester), D- 81130-95-2 Digitoxigenin-3-beta-D-alanyl ester

pdb file: 192215.pdb
sdf file: 192215.sdf
directory: 192215

(S)-2-((S)-N-((S)-1-Carboxy-3-phenylpropyl)alanyl)-1,2,3,4-tetrahydro-3-isoquinolinecarboxylic acid, 1-ethyl ester, monohydrochloride 3-Isoquinolinecarboxylic acid, 1,2,3,4-tetrahydro-2-(2-((1-(ethoxycarbonyl)-3-phenylpropyl)amino)-1-oxopropyl)-, monohydrochloride, (3S-(2(R*(R*)),3R*))- 3-Isoquinolinecarboxylic acid, 2-(2-((1-(ethoxycarbonyl)-3-phenylpropyl)amino)-1-oxopropyl)-1,2,3,4-tetrahydro-, monohydrochloride, (3S-(2(R*(R*)),3R*)) 82586-55-8 Accupril Accuprin Accupron Accuretic Acequin Acuitel Acuprel Asig CI906 Conan Continucor Ectren HSDB 7046 Hemokvin Korec Koretic Lidaltrin PD 109452-2 QUINAPRIL HYDROCHLORIDE Quinapril hydrochloride [USAN] Quinazil

pdb file: 192392.pdb
sdf file: 192392.sdf
directory: 192392

79517-01-4 83150-76-9 D-Phenylalanyl-L-cysteinyl-L-phenylalanyl-D-tryptophyl-L-lysyl-L-threonyl-L-cysteinyl-L-threoninol cyclic (2-

pdb file: 192449.pdb
sdf file: 192449.sdf
directory: 192449

119543-18-9 83435-67-0 CCRIS 1925 CV 3317 DELAPRIL HYDROCHLORIDE Delapril hydrochloride [USAN:JAN] Ethyl (S)-2-(((S)-1-((carboxymethyl)-2-indanylcarbamoyl)ethyl)amino)-4-phenylbutyrate, monohydrochloride Glycine, N-((1S)-1-(ethoxycarbonyl)-3-phenylpropyl)-L-alanyl-N-(2,3-dihydro-1H-inden-2-yl)-, monohydrochloride Glycine, N-(2,3-dihydro-1H-inden-2-yl)-N-(N-(1-(ethoxycarbonyl)-3-phenylpropyl)-L-alanyl)-, monohydrochloride, (S)- N-(N-((S)-1-Ethoxycarbonyl-3-phenylpropyl)-L-alanyl)-N-(indan-2-yl)glycine hydrochloride REV 6000A

pdb file: 192483.pdb
sdf file: 192483.sdf
directory: 192483

83461-56-7 Cgp 19835 A Cgp 19853A lipid Cgp-19835A L-Alaninamide, N-(N-acetylmuramoyl)-L-alanyl-D-alpha-glutaminyl-N-(4-hydroxy-10-oxo-7-((1-oxohexadecyl)oxy)-3,5,9-trioxa-4-phosphapentacos-1-yl)-, P-oxide, (R)- MTP-PE/MF59 [Int Conf AIDS 1992 Jul 19-24;8(2): (abs no. PoA 2226) Mlv 19835 Mtp-PE Muramyl tripeptide PE Muramyl tripeptide phosphatidylethanolamine Muramyl tripeptide-1,2-dipalmitoyl-sn-glycero-3-phosphoethanolamine conjugate Muramyl tripeptide-1,2-dipalmitoylphosphatidylethanolamine conjugate Muramyl-tripeptide phosphatidylethanolamine N-Acetylmuramyl-alanyl-isoglutaminyl-alanyl-sn-glycero-3-phosphoethanolamine

pdb file: 192484.pdb
sdf file: 192484.sdf
directory: 192484

(8S)-7-((S)-N-((S)-1-Carboxy-3-phenylpropyl)alanyl)-1,4-dithia-7-azaspiro(4.4)nonane-8-carboxylic acid 1,4-Dithia-7-azaspiro(4.4)nonane-8-carboxylic acid, 7-(2-((1-carboxy-3-phenylpropyl)amino)-1-oxopropyl)-, (8S-(7(R*(R*)),8R*))- 83602-05-5 SPIRAPRILAT Sch 33861 Spiraprilat [USAN:INN] Spiraprilate [INN-French] Spiraprilatum [INN-Latin]

pdb file: 192525.pdb
sdf file: 192525.sdf
directory: 192525

1-(N-((S)-1-Carboxy-3-phenylpropyl)-L-alanyl)-L-proline dihydrate 76420-72-9 84680-54-6 ENALAPRILAT DIHYDRATE L-Proline, 1-(N-(1-carboxy-3-phenylpropyl)-L-alanyl)-, dihydrate, (S)-

pdb file: 192758.pdb
sdf file: 192758.sdf
directory: 192758

85514-00-7 L-ALANINE, N-(N-NITROSO-L-ALANYL)- N-(N-Nitroso-L-alanyl)-L-alanine Nitrosoalanylalanine

pdb file: 192813.pdb
sdf file: 192813.sdf
directory: 192813

144747-18-2 86933-74-6 88507-24-8 Kassinin, 1-de-L-aspartic acid-2-de-L-valine-3-L-histidine-5-L-threonine-7-L-serine- L-Methioninamide, L-histidyl-L-lysyl-L-threonyl-L-alpha-aspartyl-L-seryl-L-phenylalanyl-L-valylglycyl-L-leucyl- NEUROKININ A Neurokinin A (Python molurus) Neurokinin A (alligator) Neurokinin A (pig spinal cord) Neurokinin A (swine spinal cord) Neurokinin alpha Neurokinin alpha (pig spinal cord) Neurokinin alpha (porcine) Neuromedin L Neuromedin L (pig spinal cord) Porcine neurokinin A Substance K

pdb file: 193001.pdb
sdf file: 193001.sdf
directory: 193001

86933-75-7 Kassinin, 2-L-methionine-3-L-histidine-4-de-L-lysine-5-de-L-serine-7-L-phenylalanine- L-Methioninamide, L-alpha-aspartyl-L-methionyl-L-histidyl-L-alpha-aspartyl-L-phenylalanyl-L-phenylalanyl-L-valylglycyl-L-leucyl- NEUROKININ K Neurokinin B Neurokinin B (pig spinal cord) Neurokinin B (porchine) Neurokinin B (swine spinal cord) Neurokinin beta Neurokinin beta (pig spinal cord) Neuromedin K (pig spinal cord) Porcine neurokinin B

pdb file: 193002.pdb
sdf file: 193002.sdf
directory: 193002

(2S,3aS,6aS)-1-((S)-N-((S)-1-Carboxy-3-phenylpropyl)alanyl)octahydrocyclopenta(b)pyrrole-2-carboxylic acid, 1-ethyl ester (2S,3aS,6aS)-1-((S)-N-((S)-1-Ethoxycarbonyl-3-phenylpropyl)alanyl)octahydrocyclopenta(b)pyrrol-2-carbonsaeure 87333-19-5 Acovil Altace Carasel Cardace Cyclopenta(b)pyrrole-2-carboxylic acid, 1-(2-((1-(ethoxycarbonyl)-3-phenylpropyl)amino)-1-oxopropyl)octahydro-, (2S-(1(R*(R*)),2alpha,3abeta,6abeta))- Delix HOE 498 Hytren Lostapres Pramace Quark RAMIPRIL Ramace Ramipril [USAN:BAN:INN] Ramiprilum [Latin] Triatec Tritace Vesdil

pdb file: 193088.pdb
sdf file: 193088.sdf
directory: 193088

121806-90-4 88813-36-9 CCRIS 6750 GALANIN Galanin (pig) Galanin (porcine) Galanin (swine) Galanin(1-29) porcine L-Alaninamide, glycyl-L-tryptophyl-L-threonyl-L-leucyl-L-asparaginyl-L-seryl-L-alanylglycyl-L-tyrosyl-L-leucyl-L-leucylglycyl-L-prolyl-L-histidyl-L-alanyl-L-isoleucyl-L-alpha-aspartyl-L-asparaginyl-L-histidyl-L-arginyl-L-seryl-L-phenylalanyl-L-histidyl-L-alpha-aspartyl-L-lysyl-L-tyrosylglycyl-L-leucyl- Porcine galanin Porcine galanin(1-29)

pdb file: 193241.pdb
sdf file: 193241.sdf
directory: 193241

102516-65-4 ALANINE, N-(CHLOROACETYL)-3-PHENYL-N-(p-TOLYLSULFONYL)- N-(Chloroacetyl)-3-phenyl-N-(p-tolylsulfonyl)alanine N-Tosyl-L-phenylalanine chloromethyl ketone Tosyl-L-phenylalanylchloromethyl ketone

pdb file: 195996.pdb
sdf file: 195996.sdf
directory: 195996

103060-53-3 Cidecin Cubicin DAPTOMYCIN Daptomicina [Spanish] Daptomycin [USAN:BAN:INN] Daptomycine [French] Daptomycinum [Latin] Deptomycin LY146032 N-Decanoyl-L-tryptophyl-L-asparaginyl-L-aspartyl-L-threonylglycyl-L-ornithyl-L-aspartyl-D-alanyl-L-aspartylglycyl-D-seryl-threo-3-methyl-L-glutamyl-3-anthraniloyl-L-alanine epsilon1-lactone

pdb file: 196199.pdb
sdf file: 196199.sdf
directory: 196199

106362-33-8 L-Threonine, D-alanyl-L-seryl-L-threonyl-L-threonyl-L-threonyl-L-asparaginyl-L-tyrosyl- L-Threonine, N-(N-(N2-(N-(N-(N-(N-D-alanyl-L-seryl)-L-threonyl)-L-threonyl)-L-threonyl)-L-asparaginyl)-L-tyrosyl)- PEPTIDE T

pdb file: 196505.pdb
sdf file: 196505.sdf
directory: 196505

(2S,3aS,7aS)-1-((S)-N-((S)-1-Carboxybutyl)alanyl)hexahydro-2-indolinecarboxylic acid, 1-ethyl ester, compound with tert-butylamine (1:1) 107133-36-8 1H-Indole-2-carboxylic acid, 1-(2-((1-(ethoxycarbonyl)butyl)amino)-1-oxopropyl)octahydro-, (2S-(1(R*(R*)),2alpha,3abeta,7abeta))-, compd. with 2-methyl-2-propanamine (1:1) ACEON McN-A-2833-109 PERINDOPRIL ERBUMINE Perindopril erbumine [USAN] Perindopril tert-butylamine S-9490-3

pdb file: 196546.pdb
sdf file: 196546.sdf
directory: 196546

(S)-2-tert-Butyl-4-((S)-N-((S)-1-carboxy-3-phenylpropyl)alanyl)-delta(sup 2)-1,3,4-thiadiazoline-5-carboxylic acid, 4-ethyl ester 1,3,4-Thiadiazole-2-carboxylic acid, 5-(1,1-dimethylethyl)-3-(2-((1-(ethoxycarbonyl)-3-phenylpropyl)amino)-1-oxopropyl)-2,3-dihydro-, (2S-(2R*,3(R*(R*))))- 109683-61-6 2,3-DIHYDRO-3-(N-(1S)-(1-ETHOXYCARBONYL-3-PHENYLPROPYL)-ALANYL)-5-(1,1- DIMETHYL Utibapril Utibapril [BAN:INN] Utibaprilo [INN-Spanish] Utibaprilum [INN-Latin]

pdb file: 196683.pdb
sdf file: 196683.sdf
directory: 196683

105806-65-3 126721-07-1 EFEGATRAN SULFATE Efegatran sulfate [USAN] L-Prolinamide, N-(4-((aminoiminomethyl)amino)-1-formylbutyl)-N-methyl-D-phenylalanyl-, (S)-, sulfate (1:1) L-Prolinamide, N-methyl-D-phenylalanyl-N-(4-((aminoiminomethyl)amino)-1-formylbutyl)-, (S)-, sulfate (1:1) LY 294468 sulfate N-Methyl-D-phenylalanyl-N-((1S)-1-formyl-4-guanidinobutyl)-L-prolinamide sulfate (1:1)

pdb file: 197026.pdb
sdf file: 197026.sdf
directory: 197026

5-Oxo-L-prolyl-L-histidyl-L-tryptophyl-L-seryl-L-tyrosyl-3-(2-naphthyl)-D-alanyl-L-leucyl-L-arginyl-L-prolylglycinamide acetate (salt) hydrate 76932-56-4 86220-42-0 Luteinizing hormone-releasing factor (pig), 6-(3-(2-naphthalenyl)-D-alanine)-, acetate (salt), hydrate NAFARELIN ACETATE Nafarelin acetate [USAN] Nafarelin acetate hydrate RS-94991-298

pdb file: 199640.pdb
sdf file: 199640.sdf
directory: 199640

10-(3-(Diethylamino)propionyl)-2-(trifluoromethyl)phenothiazine 2-(Trifluoromethyl)-10-(N,N-diethyl-beta-alanyl)phenothiazine 27312-93-2 30223-48-4 Fluacizina [INN-Spanish] Fluacizine Fluacizine [INN] Fluacizinum [INN-Latin] Fluoracizine Phtorazisin

pdb file: 205049.pdb
sdf file: 205049.sdf
directory: 205049

(S)-1-(N-(1-(Ethoxycarbonyl)-3-phenylpropyl)-L-alanyl)-L-proline maleate (1:1) 1-(N-((S)-1-Carboxy-3-phenylpropyl)-L-alanyl)-L-proline 1'-ethyl ester, maleate (1:1) 75847-73-3 76095-16-4 77549-59-8 A-Rin Acetensil Alphrin Amprace Analept Atens BQL Baripril Benalapril Benalipril Biocronil Controlvas Converten Convertin Coprilor Coroldil Crinoren Dabonal Defluin Denapril EINECS 278-375-7 Ecapril Ednyt Elfonal Enacard Enaladil Enalapril maleate Enalapril maleate [USAN:JAN] Enalasyn Enaloc Enap Enapren Enapres Enapril Enaprin Enarenal Enaril Envas Eupressin Feliberal Glioten HSDB 6529 Herten Hipoartel Hipten Hytrol Innovace Innovade Inoprilat Insup Invoril Kenopril Konveril L-Proline, 1-(N-(1-(ethoxycarbonyl)-3-phenylpropyl)-L-alanyl)-, (S)-, (Z)-2-butenedioate (1:1) L-Proline, N-((1S)-1-(ethoxycarbonyl)-3-phenylpropyl)-L-alanyl-, (2Z)-2-butenedioate (1:1) Lapril Lexxel Lipraken Lotrial MK 421 MK 421 maleate Mapryl Mepril Minipril N-((S)-1-Ethoxycarbonyl-3-phenylpropyl)-L-alanyl-L-proline maleate (1:1) Naprilene Naritec Neotensin Norpril Nuril Palane

pdb file: 205106.pdb
sdf file: 205106.sdf
directory: 205106

(S-(R*,R*))-L-Arginyl-L-prolyl-trans-4-hydroxy-L-prolyl-3-(2-thienyl)-L-alanylglycyl-L-seryl-N-(2-((4-((aminoiminomethyl)amino)-1-carboxybutyl)amino)-1-((4-methoxyphenyl)methyl)ethyl)-L-prolinamide 139183-63-4 159768-75-9 173220-35-4 Bradykinin, 3-(trans-4-hydroxy-L-proline)-5-(3-(2-thienyl)-L-alanine)-8-de-L-phenylalanine-9-(N2-(2-amino-3-(4-methoxyphenyl)propyl)-L-arginine)-, (S)- Cereport DRG-0182 L-Arginine, L-arginyl-L-prolyl-(4R)-4-hydroxy-L-prolyl-3-(2-thienyl)-L-alanylglycyl-L-seryl-L-prolyl-O-methyl-L-tyrosyl-psi(CH2-NH)- L-Prolinamide, L-arginyl-L-prolyl-trans-4-hydroxy-L-prolyl-3-(2-thienyl)-L-alanylglycyl-L-seryl-N-(2-((4-((aminoiminomethyl)amino)-1-carboxybutyl)amino)-1-((4-methoxyphenyl)methyl)ethyl)-, (S-(R*,R*))- Labradimil Labradimil [INN] Lobradimil Lobradimil [USAN] N2-((S)-2-(L-Arginyl-L-prolyl-trans-4-hydroxy-L-prolylglycyl-3-(2-thienyl)-L-alanyl-L-seryl-L-prolinamido)-3-(p-methoxyphenyl)propyl)-L-arginine RMP 7 RMP-7

pdb file: 206186.pdb
sdf file: 206186.sdf
directory: 206186

89813-21-8 Adamantylamide dipeptide Adamantylamide-alanyl-isoglutamine D-Glutamamide, L-alanyl-N5-tricyclo(,7))dec-1-yl- L-Alanyl-N5-tricyclo(,7))dec-1-yl-D-glutamamide

pdb file: 206488.pdb
sdf file: 206488.sdf
directory: 206488

97143-05-0 Ascb-lys-ala-val L-Alaninamide, N6-(4-carboxybenzoyl)-N2-(tricyclo(,7))dec-1-ylsulfonyl)-L-lysyl-N-((1S)-1-formyl-2-methylpropyl)- L-Alaninamide, N6-(4-carboxybenzoyl)-N2-(tricyclo(,7))dec-1-ylsulfonyl)-L-lysyl-N-(1-formyl-2-methylpropyl)-, (S)- N(alpha)-(1-Adamantanesulfonyl)-N(epsilon)-(4-carboxybenzoyl)lysyl-alanyl-valinal Ro 31-3537

pdb file: 206492.pdb
sdf file: 206492.sdf
directory: 206492

113584-00-2 KKI 8 KKI-8 L-Glutamamide, N-(tricyclo( 3,7))dec-1-ylacetyl)-L-phenylalanyl-L-arginyl-L-seryl-L-valyl- N-(Tricyclo( 3,7))dec-1-ylacetyl)-L-phenylalanyl-L-arginyl-L-seryl-L-valyl-L-glutamamide N-Adamantaneacetyl-phe-arg-ser-val-gln-NH2

pdb file: 206520.pdb
sdf file: 206520.sdf
directory: 206520

(N-Adamantaneacetyl-D-arg(0)-hyp(3)-thi(5,8)-D-phe(7))bradykinin 1-Adamantanecarboxylic acid-arg(0)-hyp(3)-thi(5,8)-phe(7)-bradykinin 138866-14-5 Aahtp-bradykinin Bradykinin, 1-adamantanecarboxylic acid-arg(0)-hyp(3)-thi(5,8)-phe(7)- Bradykinin, 1-adamantanecarboxylic acid-arginyl(0)-hydroxyprolyl(3)-thi(5,8)-phenylalanyl(7)- L-Arginine, N2-(N-(N-(N-(N-(N-(trans-4-hydroxy-1-(1-(N2-(N2-(tricyclo(,7))dec-1-ylcarbonyl)-D-arginyl)-L-arginyl)-L-propyl)-L-prolyl)glycyl)-3-(2-thienyl)-L-alanyl)-L-seryl)-D-phenylalanyl)-3-(2-thienyl)-L-alanyl)- N2-(N-(N-(N-(N-(N-(trans-4-Hydroxy-1-(1-(N2-(N2-(tricyclo(,7))dec-1-ylcarbonyl)-D-arginyl)-L-arginyl)-L-propyl)-L-prolyl)glycyl)-3-(2-thienyl)-L-alanyl)-L-seryl)-D-phenylalanyl)-3-(2-thienyl)-L-alanyl)-L-arginine

pdb file: 206558.pdb
sdf file: 206558.sdf
directory: 206558

132499-65-1 L-alpha-Glutamine, N-(1-oxotetradecyl)glycyl-L-asparaginyl-L-isoleucyl-L-phenylalanyl-L-alanyl-L-asparaginyl-L-leucyl-L-phenylalanyl-L-lysylglycyl-L-leucyl-L-phenylalanylglycyl-L-lysyl- Mgaipaa Myristyl-gly-asn-ile-phe-ala-asn-leu-phe-lys-gly-leu-phe-gly-lys-glu-NH2 Myristyl-glycyl-asparginyl-isoleucyl-phenylalanyl-alanyl-asparaginyl-leucyl-phenylalanyl-lysyl-glycyl-leucyl-phenylalanyl-glycyl-lysyl-glutamine

pdb file: 206611.pdb
sdf file: 206611.sdf
directory: 206611

119625-78-4 CP 80794 Isopropyl (alphaR,betaS)-alpha-hydroxy-beta-((R)-3-(methylthio)-2-((S)-alpha-4-morpholinecarboxamidohydrocinnamamido)propionamido)cyclohexanebutyrate L-Cysteinamide, N-(4-morpholinylcarbonyl)-L-phenylalanyl-N-(1-(cyclohexylmethyl)-2-hydroxy-3-(1-methylethoxy)-3-oxopropyl)-S-methyl-, (R-(R*,S*))- Terlakiren Terlakiren [USAN:INN]

pdb file: 206855.pdb
sdf file: 206855.sdf
directory: 206855

2577-40-4 3-Phenyl-N-(3-phenyl-L-alanyl)-L-alanine EINECS 219-930-5 NSC 524136 Phenylalanylphenylalanine

pdb file: 207064.pdb
sdf file: 207064.sdf
directory: 207064

(2S,3aS,6aS)-1-((S)-N-((S)-1-Carboxy-3-phenylpropyl)alanyl)octahydrocyclopenta(b)pyrrole-2-carboxylic acid 87269-97-4 Ramiprilat Ramiprilat [INN] Ramiprilate [French] Ramiprilatum [Latin]

pdb file: 207678.pdb
sdf file: 207678.sdf
directory: 207678

(2S,3aR,7aS)-1-((S)-N-((S)-1-Carboxy-3-phenylpropyl)alanyl)hexahydro-2-indolinecarboxylic acid 87679-71-8 Trandolaprilat Trandolaprilat [INN] Trandolaprilate [INN-French] Trandolaprilatum [INN-Latin]

pdb file: 207682.pdb
sdf file: 207682.sdf
directory: 207682

(S)-2-((S)-N-((S)-1-Carboxy-3-phenylpropyl)alanyl)-2-azabicyclo(2.2.2)octane-3-carboxylic acid 90103-92-7 S 10211 Zabiciprilat Zabiciprilat [INN] Zabiciprilate [INN-French] Zabiciprilatum [INN-Latin]

pdb file: 207705.pdb
sdf file: 207705.sdf
directory: 207705

98815-38-4 Casokefamida [INN-Spanish] Casokefamide Casokefamide [INN] Casokefamidum [INN-Latin] L-Tyrosyl-D-alanyl-L-phenylalanyl-D-alanyl-L-tyrosinamide beta Casomorphin 4027

pdb file: 207898.pdb
sdf file: 207898.sdf
directory: 207898

(3S)-2-((2S)-N-((1S)-1-Carboxy-3-phenylpropyl)alanyl)-1,2,3,4-tetrahydro-6,7-dimethoxy-3-isoquinolinecarboxylic acid 103775-14-0 Moexiprilat Moexiprilat [INN] RS 10029

pdb file: 207924.pdb
sdf file: 207924.sdf
directory: 207924

107489-37-2 L-Leucine, N-(N-(N2-(1-(N-(N-(N-L-leucyl-L-alpha-glutamyl)-L-alpha-aspartyl)glycyl)-L-prolyl)-L-lysyl)-L-phenylalanyl)- N-(N-(N(sup 2)-(1-(N-(N-(N-L-Leucyl-L-alpha-glutamyl)-L-alpha-aspartyl)glycyl)-L-prolyl)-L-lysyl)-L-phenylalanyl)-L-leucine Thymic humoral factor gamma 2 Thymoctonan Thymoctonan [INN]

pdb file: 207948.pdb
sdf file: 207948.sdf
directory: 207948

140703-51-1 Examorelin Examorelin [INN] Hexarelin L-Histidyl-2-methyl-D-tryptophyl-L-alanyl-L-tryptophyl-D-phenylalanyl-L-lysinamide L-Lysinamide, L-histidyl-2-methyl-D-tryptophyl-L-alanyl-L-tryptophyl-D-phenylalanyl-

pdb file: 208050.pdb
sdf file: 208050.sdf
directory: 208050

66960-35-8 L-Methioninamide, L-tyrosyl-D-alanylglycyl-L-phenylalanyl-N(sup 2)-methyl-, monoacetate (salt) L-Tyrosyl-D-alanylglycyl-L-phenylalanyl-N(sup 2)-methyl-L-methioninamide monoacetate (salt) LY 127623 LY127623 Lilly 127623 Metkephamid acetate Metkephamid acetate [USAN] Metkephamide acetate

pdb file: 210683.pdb
sdf file: 210683.sdf
directory: 210683

78512-63-7 DL-Lysinamide, glycyl-6-carboxy-N(sup 6)-(N-(N-(1-oxododecyl)-L-alanyl)-D-gamma-glutamyl)-, (R*,R*)- Pimelautida [Spanish] Pimelautide [INN] Pimelautidum [Latin] RP 40639 threo-6-Carbamoyl-N(sup 2)-(N-(N-lauroyl-L-alanyl)-D-gamma-glutamyl)-N(sup 6)-glycyl-DL-lysine

pdb file: 210713.pdb
sdf file: 210713.sdf
directory: 210713

105026-73-1 89662-30-6 94608-19-2 BRN 6564671 D-Alaninamide, N-acetyl-3-(2-naphthalenyl)-D-alanyl-4-chloro-D-phenylalanyl-D-tryptophyl-L-seryl-L-tyrosyl-N(sup 6)-(bis(ethylamino)methylene)-D-lysyl-L-leucyl-L-arginyl-L-prolyl- D-Alaninamide, N-acetyl-3-(2-naphthalenyl)-D-alanyl-4-chloro-D-phenylalanyl-D-tryptophyl-L-seryl-L-tyrosyl-N6-(bis(ethylamino)methylene)-D-lysyl-L-leucyl-L-arginyl-L-prolyl- Deterelix Detirelix Detirelix [USAN] Detirelix acetate Detirelixum [Latin] N-Ac-D-Nal(2)1,D-pCl-Phe2,D-Trp3,D-hArg(Et2)6,D-Ala(10)-GnRH N-Acetyl-3-(2-naphthyl)-D-alanyl-p-chloro-D-phenylalanyl-D-tryptophyl-L-seryl-L-tyrosyl-N(sup 6)-(N,N'-diethylamidino)-D-lysyl-L-leucyl-L-arginyl-L-prolyl-D-alaninamide

pdb file: 210730.pdb
sdf file: 210730.sdf
directory: 210730

64190-70-1 Fmrfamide L-Phenylalaninamide, L-phenylalanyl-L-methionyl-L-arginyl-

pdb file: 210736.pdb
sdf file: 210736.sdf
directory: 210736

51987-65-6 Desglugastrin Desglugastrin [INN] Desglugastrina [INN-Spanish] Desglugastrine [INN-French] Desglugastrinum [INN-Latin] N-(4-Carboxybutyryl)-L-alanyl-L-tyrosylglycyl-L-tryptophyl-L-leucyl-L-alpha-aspartylphenyl-L-alaninamide

pdb file: 210816.pdb
sdf file: 210816.sdf
directory: 210816

103336-05-6 Ditekiren Ditekiren [USAN:INN] Ditekirene [INN-French] Ditekirenum [INN-Latin] Ditiquireno [INN-Spanish] L-Histidinamide, 1-((1,1-dimethylethoxy)carbonyl)-L-prolyl-L-phenylalanyl-N-(2-hydroxy-5-methyl-1-(2-methylpropyl)-4-(((2-methyl-1-(((2-pyridinylemthyl)amino)carbonyl)butyl)amino)carbonyl)hexyl)-Nalpha-methyl-, (1S-(1R*,2R*,4R*(1R*,2R*)))- L-Histidinamide, 1-((1,1-dimethylethoxy)carbonyl)-L-prolyl-L-phenylalanyl-N-(2-hydroxy-5-methyl-1-(2-methylpropyl)-4-(((2-methyl-1-(((2-pyridinylmethyl)amino)carbonyl)butyl)amino)carbonyl)hexyl)-N(sup alpha)-methyl-, (1S-(1R*,2R*,4R*(1R*,2R*)))- tert-Butyl (2S)-2-(((alphaS)-alpha-(((1S)-1-(((1S,2S,4S)-2-hydroxy-1-isobutyl-5-methyl-4-(((1S,2S)-2-methyl-1-((2-pyridylmethyl)carbamoyl)butyl)carbamoyl)hexyl)carbamoyl)-2-imidazol-4-ylethyl)methylcarbamoyl)phenethyl)carbamoyl)-1-pyrrolidinecarboxylate

pdb file: 210863.pdb
sdf file: 210863.sdf
directory: 210863

62087-96-1 EINECS 263-401-1 L-Histidine, N-(N-(N-acetyl-L-phenylalanyl)-L-phenylalanyl)-, methyl ester N-(N-(N-Acetyl-3-phenyl-L-alanyl)-3-phenyl-L-alanyl)-L-histidine, methyl ester Triletida [Spanish] Triletide Triletide [INN] Triletidum [Latin] Zami 420

pdb file: 210954.pdb
sdf file: 210954.sdf
directory: 210954

62568-57-4 81659-81-6 DSIP nonapeptide Delta sleep-inducing peptide (rabbit) Emideltide Emideltide [INN] L-Glutamic acid, L-tryptophyl-L-alanylglycylglycyl-L-alpha-aspartyl-L-alanyl-L-serylglycyl- L-Glutamic acid, N-(N-(N-(N-(N-(N-(N-(N-L-tryptophyl-L-alanyl)glycyl)glycyl)-L-alpha-aspartyl)-L-alanyl)-L-seryl)-glycyl)- L-Tryptophyl-L-alanylglycylglycyl-L-alpha-aspartyl-L-alanyl-L-serylglycyl-L-glutamic acid

pdb file: 210956.pdb
sdf file: 210956.sdf
directory: 210956

74436-00-3 Cyclo(((2S,3R,4R,6E)-3-hydroxy-4-methyl-2-(methylamino)-6-octenoyl)-L-norvalyl-N-methylglycyl-N-methyl-L-leucyl-L-valyl-N-methyl-L-leucyl-L-alanyl-D-alanyl-N-methyl-L-leucyl-N-methyl-L-leucyl-N-methyl-L-valyl) Cyclosporin A, 7-L-norvaline- Cyclosporin G Geclosporin Geclosporin [INN]

pdb file: 211082.pdb
sdf file: 211082.sdf
directory: 211082

104071-87-6 14307-88-1 4-04-00-02529 (Beilstein Handbook Reference) 646-08-2 Alethine BRN 1714300 Bis(beta-alanylaminoethyl)disulfide EINECS 211-465-6 N,N'-(Dithiodiethylene)bis(3-aminopropionamide) Propionamide, N,N'-(dithiodiethylene)bis(3-amino-

pdb file: 211707.pdb
sdf file: 211707.sdf
directory: 211707

(8S)-7((S)-N-((S)-1-Carboxy-3-phenylpropyl)alanyl)-1,4-dithia-7-azaspiro(4.4)nonane-8-carboxylic acid, 1-ethyl ester, monohydrochloride 1,4-Dithia-7-azaspiro(4.4)nonane-8-carboxylic acid, 7-(2-((1-(ethoxycarbonyl)-3-phenylpropyl)amino)-1-oxopropyl)-, monohydrochloride, (8S-(7(R*(R*)),8R*))- 94841-17-5 Sch 33844 Spirapril hydrochloride Spirapril hydrochloride [USAN]

pdb file: 213401.pdb
sdf file: 213401.sdf
directory: 213401

(3S)-2-((2S)-N-((1S)-1-Carboxy-3-phenylpropyl)alanyl)-2-azabicyclo(2.2.2)octane-3-carboxylic acid, 1-ethyl ester 83059-56-7 Zabicipril Zabicipril [INN] Zabiciprilum [Latin]

pdb file: 213483.pdb
sdf file: 213483.sdf
directory: 213483

103222-11-3 BMY 41606 CCRIS 6495 D-Phenylalanyl-L-cysteinyl-L-tyrosyl-D-tryptophyl-L-lysyl-L-valyl-L-cysteinyl-L-tryptophanamide cyclic (2-

pdb file: 213531.pdb
sdf file: 213531.sdf
directory: 213531

108736-35-2 127984-74-1 3-(2-Naphthyl)-D-alanyl-L-cysteinyl-L-tyrosyl-D-tryptophyl-L-lysyl-L-valyl-L-cysteinyl-L-threoninamide, cyclic (2-

pdb file: 213579.pdb
sdf file: 213579.sdf
directory: 213579

108736-35-2 118992-92-0 123369-01-7 127984-74-1 Angiopeptin Autogel BIM 23014 DC 13-116 L-Threoninamide, 3-(2-naphthalenyl)-D-alanyl-L-cysteinyl-L-tyrosyl-D-tryptophyl-L-lysyl-L-valyl-L-cysteinyl-, cyclic (2-7)-disulfide Lanreotida [INN-Spanish] Lanreotide Lanreotidum [INN-Latin]

pdb file: 213580.pdb
sdf file: 213580.sdf
directory: 213580

(R)-Arginyl-(S)-arginyl-(S)-prolyl-(2S,4R)-(4-hydroxyprolyl)glycyl-(S)-(3-(2-thienyl)alanyl)-(S)-seryl-(R)-((1,2,3,4-tetrahydro-3-isoquinolyl)carbonyl)-(2S,3aS,7aS)-((hexahydro-2-indolinyl)carbonyl)-(S)-arginine acetate (salt) 130308-48-4 138614-30-9 HOE 140 Icatibant acetate Icatibant acetate [USAN] L-Arginine, D-arginyl-L-arginyl-L-prolyl-trans-4-hydroxy-L-prolylglycyl-3-(2-thienyl)-L-alanyl-L-seryl-D-1,2,3,4-tetrahydro-3-isoquinolinecarbonyl-L-(2alpha,3abeta,7abeta)-octahydro-1H-indole-2-carbonyl-, acetate (salt)

pdb file: 213594.pdb
sdf file: 213594.sdf
directory: 213594

130308-48-4 138614-30-9 HOE 140 HOE140 Icatibant Icatibant [INN] L-Arginine, D-arginyl-L-arginyl-L-prolyl-trans-4-hydroxy-L-prolylglycyl-3-(2-thienyl)-L-alanyl-L-seryl-D-1,2,3,4-tetrahydro-3-isoquinolinecarbonyl-L-(2alpha,3abeta,7abeta)-octahydro-1H-indole-2-carbonyl-

pdb file: 213595.pdb
sdf file: 213595.sdf
directory: 213595

26305-03-3 26368-29-6 Ahpatinin C BRN 2201362 EINECS 247-600-0 Heptanoic acid, N-(3-methyl-1-oxobutyl)-L-valyl-L-valyl-(3S,4S)-3-hydroxy-6-methyl-4-aminoheptanoyl-L-alanyl-(3S,4S)-3-hydroxy-6-methyl-4-amino- L-Alaninamide, N-(3-methyl-1-oxobutyl)-L-valyl-(3S,4S)-4-amino-3-hydroxy-6-methylheptanoyl-N-((1S)-1-((1S)-2-carboxy-1-hydroxyethyl)-3-methylbutyl)- L-Valinamide, N-(3-methyl-1-oxobutyl)-L-valyl-N-(4-((2-((1-(2-carboxy-1-hydroxyethyl)-3-methylbutyl)amino)-1-methyl-2-oxoethyl)amino)-2-hydroxy-1-(2-methylpropyl)-4-oxobutyl)-, (1S-(1R*,2R*,4(R*(R*(R*)))))- N-(3-Methyl-1-oxobutyl)-L-valyl-L-valyl-4-amino-3-hydroxy-6-methylheptanoyl-L-alanyl-4-amino-3-hydroxy-6-methylheptanoic acid N-Isovaleryl-L-valyl-L-valyl-3-hydroxy-6-methyl-gamma-aminoheptanoyl-L-alanyl-3-hydroxy-6-methyl-gamma-aminoheptanoic acid NSC 272671 Pepsin inhibitor S 735A Pepstatin Pepstatin A Pepstatin [USAN:INN] Pepstatina [INN-Spanish] Pepstatine [INN-French] Pepstatinum [INN-Latin] Procidin S 735A

pdb file: 213628.pdb
sdf file: 213628.sdf
directory: 213628

2-Acetamido-3-O-((R)-1-(((S)-1-(((R)-1-carbamoyl-3-(((S)-1-carboxy-5-stearamidopentyl)carbamoyl)propyl)carbamoyl)ethyl)carbamoyl)ethyl)-2-deoxy-D-glucopyranose 78113-36-7 BRN 4288462 CCRIS 1220 DJ-7041 L-Lysine, N(sup 2),(N(sup 2)-(N-(N-acetylmuramoyl)-L-alanyl)-D-alpha-glutaminyl)-N(sup 6)-(1-oxooctadecyl)- L-Lysine, N2-(N2-(N-(N-acetylmuramoyl)-L-alanyl)-D-alpha-glutaminyl)-N6-(1-oxooctadecyl)- MDP-lys(L18) Muroctasin N(alpha)-(N-Acetylmuram yl-alanyl-isoglutaminyl)-N(epsilon)stearoyllysine N(sup 2)-((N-Acetylmuramoyl)-L-alanyl-D-isoglutaminyl)-N(sup 6)-stearoyl-L-lysine Nopia Romurtida [INN-Spanish] Romurtide Romurtide [INN:JAN] Romurtidum [INN-Latin]

pdb file: 214038.pdb
sdf file: 214038.sdf
directory: 214038

128270-60-0 Angiomax BG8967 Bivalirudin Bivalirudin [USAN:BAN:INN] D-Phenylalanyl-L-prolyl-L-arginyl-L-prolylglycylglycylglycylglycyl-L-asparaginylglycyl-L-alpha-aspartyl-L-phenylalanyl-L-alpha-glutamyl-L-alpha-glutamyl-L-isoleucyl-L-prolyl-L-alpha-glutamyl-L-alpha-glutamyl-L-tyrosyl-L-leucine Hirulog L-Leucine, D-phenylalanyl-L-prolyl-L-arginyl-L-prolylglycylglycylglycylglycyl-L-asparaginylglycyl-L-alpha-aspartyl-L-phenylalanyl-L-alpha-glutamyl-L-alpha-glutamyl-L-isoleucyl-L-prolyl-L-alpha-glutamyl-L-alpha-glutamyl-L-tyrosyl-

pdb file: 214065.pdb
sdf file: 214065.sdf
directory: 214065

135548-15-1 Cyclo(((2S,3R,4R,6E)-3-hydroxy-4-methyl-2-(methylamino)-6-octenoyl)-L-2-aminobutyryl-N-methylglycyl-N-methyl-L-leucyl-L-valyl-N-methyl-L-leucyl-L-alanyl-O-(2-hydroxyethyl)-D-seryl-N-methyl-L-leucyl-N-methyl-L-leucyl-N-methyl-L-valyl) Cyclosporin A, 2-(O-(2-hydroxyethyl)-D-serine)- Oxeclosporin Oxeclosporin [INN] Sdz imm 125

pdb file: 214068.pdb
sdf file: 214068.sdf
directory: 214068

16870-37-4 AOC-tetragastrin Alaninamide, N-carboxy-L-tryptophyl-L-methionyl-L-aspartylphenyl-, N-tert-pentyl ester, L- Amogastrin Amogastrin [INN:JAN] Amogastrina [INN-Spanish] Amogastrine [INN-French] Amogastrinum [INN-Latin] L-Phenylalaninamide, N-((1,1-dimethylpropoxy)carbonyl)-L-tryptophyl-L-methionyl-L-alpha-aspartyl- N-((1,1-Dimethylpropoxy)carbonyl)-L-tryptophyl-L-methionyl-L-alpha-aspartyl-L-phenylalaninamide N-Carboxy-L-tryptophyl-L-methionyl-L-alpha-aspartyl-3-phenyl-L-alaninamide N-tert-pentyl ester tert-Amyloxycarbonyltetragastrin tert-Pentyl N-carboxylato-tryptophyl-methionyl-alpha-aspartyl-phenylalanylamid

pdb file: 214157.pdb
sdf file: 214157.sdf
directory: 214157

38916-34-6 51110-01-1 CCRIS 3629 EINECS 254-186-5 Growth hormone-release inhibiting factor: L-alanylglycyl-L-cysteinyl-L-lysyl-L-asparaginyl-L-phenylalanyl-L-phenylalanyl-L-tryptophyl-L-lysyl-L-threonyl-L-phenylalanyl-L-threonyl-L-seryl-L-cysteine cyclic (3-

pdb file: 214213.pdb
sdf file: 214213.sdf
directory: 214213

((1R)-1-(((2S)-2-amino-1-oxopropyl)amino)ethyl)phosphonic acid ((1R)-1-((2S)-2-Aminopropionamido)ethyl)phosphonic acid (1R)-1-(L-Alanylamino)ethylphosphonic acid 60668-24-8 Alafosfalin Alafosfalin [BAN:INN] Alafosfaline [INN-French] Alafosfalino [INN-Spanish] Alafosfalinum [INN-Latin] Alaphosphin EINECS 262-362-8 Phosphonic acid, ((1R)-1-(((2S)-2-amino-1-oxopropyl)amino)ethyl)- Phosphonic acid, (1-((2-amino-1-oxopropyl)amino)ethyl)-, (R-(R*,S*))- Ro 03-7008

pdb file: 214224.pdb
sdf file: 214224.sdf
directory: 214224

105250-86-0 Ebiratida [Spanish] Ebiratide Ebiratide [INN] Ebiratidum [Latin] L-Methionyl-L-glutamyl-L-histidyl-L-phenylalanyl-D-lysyl-N-(8-aminooctyl)-L-phenylalaninamide S,S-dioxide

pdb file: 214381.pdb
sdf file: 214381.sdf
directory: 214381

138661-02-6 DTPA-SMS L-Cysteinamide, N-(2-((2-(bis(carboxymethyl)amino)ethyl)(carboxymethyl)amino)ethyl)-N-(carboxymethyl)glycyl-D-phenylalanyl-L-cysteinyl-L-phenylalanyl-D-tryptophyl-L-lysyl-L-threonyl-N-(2-hydroxy-1-(hydroxymethyl)propyl)-, cyclic (3-8)-disulfide, (R-,(R*,R*))- N-(2-((2-(Bis(carboxymethyl)amino)ethyl)(carboxymethyl)amino)ethyl)-N-(carboxymethyl)glycyl-D-phenylalanyl-L-cysteinyl-L-phenylalanyl-D-tryptophyl-L-lysyl-L-threonyl-N-((1R,2R)-2-hydroxy-1-(hydroxymethyl)propyl)-L-cysteinamide cyclic (3-

pdb file: 214385.pdb
sdf file: 214385.sdf
directory: 214385

26645-35-2 BRN 0604129 Phallacidin cyclic(L-Alanyl-2-mercapto-L-tryptophyl-4,5-dihydroxy-L-leucyl-L-valyl-erythro-3-hydroxy-D-alpha-aspartyl-L-cysteinyl-cis-4-hydroxy-L-prolyl) cyclic (2-6)-sulfide

pdb file: 214649.pdb
sdf file: 214649.sdf
directory: 214649

149204-42-2 Kahalalide F Valine, N-(5-methyl-1-oxohexyl)valylthreonylvalylvalyl-D-prolyl-L-ornithyl-D-alloisoleucylthreonyl-D-alloisoleucylvalyl-L-phenylalanyl-(Z)-2,3-didehydro-2-aminobutanoyl-, rho-lactone

pdb file: 215185.pdb
sdf file: 215185.sdf
directory: 215185

179733-11-0 Kahalalide A L-Serine, N-(N-(N-(N-(N-(N-(N-(2-methyl-1-oxobutyl)-D-phenylalanyl)-L-threonyl)-D-leucyl)-D-phenylalanyl)-D-leucyl)-L-threonyl)-, rho-lactone

pdb file: 215186.pdb
sdf file: 215186.sdf
directory: 215186

150736-68-8 Boc-phe-psi(CH(OH)CH2)-phe-val-phe-morpholine Boc-phenylalanylpsi(CH(OH)CH2)phenylalanyl-valyl-phenylalanyl-morpholine Boc-phepsi(CH(OH)CH2)phe-val-phe-morpholine Carbamic acid, (2-hydroxy-5-((2-methyl-1-(((2-(4-morpholinyl)-2-oxo-1-(phenylmethyl)ethyl)amino)carbonyl)propyl)amino)-5-oxo-1,4-bis(phenylmethyl)pentyl)-, 1,1-dimethylethyl ester, (1S-(1R*,2R*,4S*,5(R*(R*))))- Cgp 53437 Cgp-53437

pdb file: 215334.pdb
sdf file: 215334.sdf
directory: 215334

144285-78-9 L-Valine, N-(N-(N-(2-((N-L-alanyl-L-alanyl)amino)-1-hydroxy-3-phenylpropyl)-L-phenylalanyl)-L-valyl)-, methyl ester, (S-(R*,R*))- Skf 108738 Skf-108738

pdb file: 215435.pdb
sdf file: 215435.sdf
directory: 215435

144285-77-8 L-Valine, N-(N-(N-(2-((N-L-alanyl-L-alanyl)amino)-1-hydroxy-3-phenylpropyl)glycyl)-L-valyl)-, methyl ester, (S-(R*,R*))- Skf 107457 Skf-107457

pdb file: 215436.pdb
sdf file: 215436.sdf
directory: 215436

106362-32-7 L-Threonine, L-alanyl-L-seryl-L-threonyl-L-threonyl-L-threonyl-L-asparaginyl-L-tyrosyl- L-Threonine, N-(N-(N2-(N-(N-(N-(N-L-alanyl-L-seryl)-L-thronyl)-L-threonyl)-L-threonyl)-L-asparaginyl)-L-tyrosyl)- Peptide T

pdb file: 215606.pdb
sdf file: 215606.sdf
directory: 215606

113-73-5 BRN 0605227 Cyclo(L-valyl-L-ornithyl-L-leucyl-D-phenylalanyl-L-prolyl-L-valyl-L-ornithyl-L-leucyl-D-phenylalanyl-L-prolyl) Gramacidine S [INN-French] Gramicidin C Gramicidin S Gramicidin S [INN] Gramicidina S [INN-Spanish] Gramicidinum S [INN-Latin] Gramicin S 1 Gramicin S-A

pdb file: 215610.pdb
sdf file: 215610.sdf
directory: 215610

10409-85-5 Isariin Isariin (8CI) Isariin B Isariin C Isariin D Isarolide L-Valine, N-(N-(N-(N-(N-(3-hydroxy-1-oxododecyl)glycyl)-L-valyl)-D-leucyl)-L-alanyl)-, rho-lactone, (R)- (9CI) NSC 135015

pdb file: 215673.pdb
sdf file: 215673.sdf
directory: 215673

1393-38-0 L-Lysine, L-tryptophyl-L-lysyl-D-cysteinyl-L-alpha-glutamyl-2,3-didehydroalanyl-L-leucyl-L-cysteinyl-3-mercapto-D-alpha-aminobutyryl-L-prolylglycyl-L-cysteinyl-L-valyl-3-mercapto-D-alpha-aminobutyrylglycyl-L-alanyl-L-leucyl-L-glutaminyl-2,3-didehydro-alpha-aminobutyryl-L-cysteinyl-L-phenylalanyl-L-leucyl-L-glutaminyl-3-mercapto-D-alpha- aminobutyryl-L-leucyl-3-mercapto-D-alpha-aminobutyryl-L-cysteinyl-L-asparaginyl-L-cysteinyl-L-lysyl-L-isoleucyl-2,3-didehydroalanyl-, cyclic (3-7),(8-11),(13-19),(23-26),(25-28)-pentakis(sulfide) NSC 404853 Subtilin

pdb file: 215705.pdb
sdf file: 215705.sdf
directory: 215705

102396-24-7 Jaspamide Jasplakinolide NSC 613009 beta-Alanine, N-(2-bromo-N-(N-(8-hydroxy-2,4,6-trimethyl-1-oxo-4-nonenyl)-L-alanyl)-N-methyl-D-tryptophyl)-L-3-(4-hydroxyphenyl)-, p-lactone, (2S-(2R*,4E,6S*,8R*))-

pdb file: 215853.pdb
sdf file: 215853.sdf
directory: 215853

2578-81-6 L-Phenylalanine, N-(N-L-phenylalanyl-L-phenylalanyl)- Phe-phe-phe Phenylalanyl-phenylalanyl-phenylalanine Tri-L-phenylalanine

pdb file: 217960.pdb
sdf file: 217960.sdf
directory: 217960

2,5-Piperazinedione, 3,6-bis(phenylmethyl)-, (3S-cis)- 2862-51-3 5254-61-5 Cyclo(phe-phe) Cyclo(phenylalanyl-phenylalanyl)

pdb file: 218333.pdb
sdf file: 218333.sdf
directory: 218333

AIDS-122811 AIDS122811 D-Histidinamide, N-[(2,3-dihydro-1H-inden-2-yl)carbonyl]-3-(1-naphthalenyl)-D-alanyl-

pdb file: 219196.pdb
sdf file: 219196.sdf
directory: 219196

AIDS-122812 AIDS122812 D-Histidinamide, 3-(1-naphthalenyl)-N-(9H-xanthen-9-ylcarbonyl)-D-alanyl-

pdb file: 219197.pdb
sdf file: 219197.sdf
directory: 219197

AIDS-122821 AIDS122821 D-Histidinamide, N-(9H-fluoren-9-ylcarbonyl)-3-(1-naphthalenyl)-D-alanyl-

pdb file: 219206.pdb
sdf file: 219206.sdf
directory: 219206

3577-89-7 AIDS-127518 AIDS127518 Asalex Asaley Ethyl 2-((2-(acetylamino)-3-(4-(bis(2-chloroethyl)amino)phenyl)propanoyl)amino)-4-methylpentanoate Ethyl ester of N-acetyl-DL-sarcolysyl-L-leucine L-Leucine, {N-[N-acetyl-4-[bis(2-chloroethyl)amino]-DL-phenylalanyl]-,} ethyl ester L-Leucine, {N-[N-acetyl-4-[bis-(2-chloroethyl)amino]-DL-phenylalanyl]-,} ethylester Leucine, {N-[N-acetyl-3-[p-[bis(2-chloroethyl)amino]phenyl]-DL-alanyl]-,} ethyl ester, L- NSC167780

pdb file: 223458.pdb
sdf file: 223458.sdf
directory: 223458

2-(Acetylamino)-3-O-(2-((2-((4-amino-1-((benzyloxy)carbonyl)-4-oxobutyl)amino)-1-methyl-2-oxoethyl)amino)-1-methyl-2-oxoethyl)-6-O-(3-((6-chloro-2-methoxy-9-acridinyl)amino)propanoyl)-2-deoxyhexose AIDS-134584 AIDS134584 NSC633091 {6-O[N-(3'-Chloro-7'-methoxyacridyl-9')-.beta.-alanyl]-muramyl} dipeptide

pdb file: 230532.pdb
sdf file: 230532.sdf
directory: 230532

2-(Acetylamino)-3-O-(2-((2-((4-amino-1-((benzyloxy)carbonyl)-4-oxobutyl)amino)-1-methyl-2-oxoethyl)amino)-1-methyl-2-oxoethyl)-2-deoxy-6-O-(3-((1-(hydroxy(oxido)amino)-9-acridinyl)amino)propanoyl)hexo\tse AIDS-134586 AIDS134586 NSC633093 {6-O[N-1'-Nitroacridyl-9')-.beta.-alanyl]muramyl} dipeptide

pdb file: 230534.pdb
sdf file: 230534.sdf
directory: 230534

AIDS-138909 AIDS138909 NSC646615 {N-Acetyl-6-O/N[4'-nitroacridone-9'(10H)-yl]-1'-B-alanyl-} carboxamidoundecanoyl/-MPD(L-Val)

pdb file: 234857.pdb
sdf file: 234857.sdf
directory: 234857

AIDS-145238 AIDS145238 Glycinamide, N-[(1,1-dimethylethoxy)carbonyl]-4-nitrophenylalanyl-N~1~-[11,11-dimethyl-2-methylene-7-[(4-nitrophenyl)methyl]-3,6,9-trioxo-10-oxa-5,8-diaza-2-azoniadodec-1-yl]- NSC669705

pdb file: 241186.pdb
sdf file: 241186.sdf
directory: 241186

AIDS-145239 AIDS145239 Glycinamide, N-[(1,1-dimethylethoxy)carbonyl]phenylalanyl-N1-[11,11-dimethyl-2-methylene-3,6,9-trioxo-7-(phenylmethyl)-10-oxa-5,8-diaza-2-azoniadodec-1-yl]- NSC669706

pdb file: 241187.pdb
sdf file: 241187.sdf
directory: 241187

AIDS-146255 AIDS146255 NSC672460 Threoninamide, N-[(9H-fluoren-9-ylmethoxy)carbonyl]phenylalanyl-S-(acetylmethylamino)cysteinylphenylalanyl-1-formyltryptophyl-N~6~-[(9H-fluoren-9-ylmethoxy)carbonyl]lysylthreonyl-S-(acetylmethylamino)cysteinyl-

pdb file: 242203.pdb
sdf file: 242203.sdf
directory: 242203

AIDS-146256 AIDS146256 NSC672463 Threoninamide, N-[(phenylmethoxy)carbonyl]phenylalanyl-S-(acetylmethylamino)cysteinylphenylalanyl-1-formyltryptophyl-N~6~-[(phenylmethoxy)carbonyl]lysyl-O-(phenylmethyl)threonyl-S-(acetylmethylamino)cysteinyl-O-(phenylmethyl)-

pdb file: 242204.pdb
sdf file: 242204.sdf
directory: 242204

687-69-4 Alanylglycine Glycine, N-L-alanyl- L-.alpha.-Alanylglycine L-Alanylglycine N-L-Alanylglycine NSC89597

pdb file: 376235.pdb
sdf file: 376235.sdf
directory: 376235

.alpha.-Alanylalanine 1948-31-8 Ala-ala Alanine, N-L-alanyl-, L- Alanylalanine Di-L-Alanine Dialanine L-Alanine, N-L-alanyl- L-Alanyl-L-alanine NSC89598

pdb file: 376236.pdb
sdf file: 376236.sdf
directory: 376236

3061-90-3 L-Phenylalanine, N-L-alanyl- NSC89630

pdb file: 376263.pdb
sdf file: 376263.sdf
directory: 376263

2867-20-1 Alanine, N-DL-alanyl-, DL- DL-Ala-DL-Ala DL-Alanine, N-DL-alanyl- DL-Alanyl-DL-alanine N-DL-Alanyl-DL-alanine NSC89654

pdb file: 376287.pdb
sdf file: 376287.sdf
directory: 376287

1999-43-5 DL-Alanyl-DL-methionine DL-Methionine, N-DL-alanyl- Methionine, N-DL-alanyl-, DL- NSC118370

pdb file: 413544.pdb
sdf file: 413544.sdf
directory: 413544

1999-45-7 DL-Phenylalanine, N-DL-alanyl- NSC118375

pdb file: 413548.pdb
sdf file: 413548.sdf
directory: 413548

24280-93-1 4-Hexenoic acid, 6-(1,3-dihydro-4-hydroxy-6-methoxy-7-methyl-3-oxo-5- isobenzofuranyl)-4-methyl-, (E)- 4-Hexenoic acid, 6-(4-hydroxy-6-methoxy-7-methyl-3-oxo-5-phthalanyl)-4- methyl-, (E)- Lilly 68618 MPA Melbex Mycophenolic Acid NSC129185

pdb file: 420202.pdb
sdf file: 420202.sdf
directory: 420202

Antibiotic 1754Z3B Glycine, N-[(3-hydroxy-2-pyridinyl)carbonyl]-L-threonyl- D-2-aminobutanoyl-L-prolyl-N-methyl-L-phenylalanyl-4-oxo-L-2-piperidinecarbonyl-L-2-phenyl-, .rho.-lactone N-[(3-Hydroxy-2-pyridinyl)carbonyl]-L-threonyl- D-2-aminobutanoyl-L-prolyl-N-methyl-L-phenylalanyl-4-oxo- L-2-piperidinecarbonyl-L-2-phenylglycine .rho.-lactone NSC177858 Staphylomycin S Staphylomycin S1 VirginiamycinVirginiamycin S1

pdb file: 446361.pdb
sdf file: 446361.sdf
directory: 446361

41928-08-9 L-(N5-Phosphono)methionine-S-sulfoximinyl-L-alanyl-L-alanine NSC183742 PHOSPHONO-METHIONINE-S-SULFOXIMINYL-L-ALANYL-ALANINE

pdb file: 447414.pdb
sdf file: 447414.sdf
directory: 447414

17922-87-1 L-Phenylalanine, N-(N-glycyl-L-alanyl)- NSC334189

pdb file: 459948.pdb
sdf file: 459948.sdf
directory: 459948

3997-90-8 D-Alanylglycine Glycine, N-D-alanyl- NSC522809

pdb file: 481383.pdb
sdf file: 481383.sdf
directory: 481383

.beta.-Alanyl-L-histidine 305-84-0 Carnosine Ignotine Karnozin L-Carnosine L-Histidine, N-.beta.-alanyl- NSC524045

pdb file: 481668.pdb
sdf file: 481668.sdf
directory: 481668

.beta.-Alanine, N-[2-bromo-N-[N-(8-hydroxy-2,4,6-trimethyl- 1-oxo-4-nonenyl)-L-alanyl]-N-methyl-D-tryptophyl]- 3-(4-hydroxyphenyl)-, .rho.-lactone,[2S-[1(S*),2R*,4E,6S*,8R*]]- 102396-24-7 Cyclo[(3R)-3-(4-hydroxyphenyl)-.beta.-alanyl-(2S,4E,6R,8S)- 8-hydroxy-2,4,6-trimethyl-4-nonenoyl-L-alanyl-2-bromo- N-methyl-D-tryptophyl] Jaspamide Jasplakinolide NSC613009

pdb file: 486578.pdb
sdf file: 486578.sdf
directory: 486578

N-(N-.gamma.-L-glutamyl-3-sulfo-L-alanyl)glycine NSC621989

pdb file: 490424.pdb
sdf file: 490424.sdf
directory: 490424

7-(L.Alanyl)taxol.methanesulphonic acid NSC623644

pdb file: 491316.pdb
sdf file: 491316.sdf
directory: 491316

L-Alaninamide, N-(N-acetylmuramoyl)-L-alanyl-D-.alpha.- glutaminyl-N-[4-hydroxy-10-oxo-7-[(1-oxohexadecyl)oxy]-3,5,9-trioxa-4-phosphapentacos-1-yl]-, P-oxide, (R)- Muramyl Tripeptide-PE-Liposome Encapsulated (MTP-PE) (Ciba-Geigy) NSC628280

pdb file: 493935.pdb
sdf file: 493935.sdf
directory: 493935

6-O[N-(3'-chloro-7'-methoxyacridyl-9')-.beta.-alanyl]-muramyl dipeptide NSC633091

pdb file: 496232.pdb
sdf file: 496232.sdf
directory: 496232

6-O[N-1'-nitroacridyl-9')-.beta.-alanyl]muramyl dipeptide NSC633093

pdb file: 496234.pdb
sdf file: 496234.sdf
directory: 496234

N-Acetyl-6-O/N[4'-nitroacridone-9'(10H)-yl]-1'-B-alanyl- carboxamidoundecanoyl/-MPD(L-Val) NSC646615

pdb file: 503169.pdb
sdf file: 503169.sdf
directory: 503169

L-alanylaminophenylbenzoylurea NSC654260

pdb file: 506267.pdb
sdf file: 506267.sdf
directory: 506267

D-phenylalanyl-L-hemicystyl-L-phenylalanyl-D-trytophyl-L-lysyl-L-threonyl-L-hemicystyl-L-threoninol, acetate NSC671663 Octreotide acetate Sandostatin LAR

pdb file: 514487.pdb
sdf file: 514487.sdf
directory: 514487

Glutamamide, N-acetyl-1-O-(phenylmethyl)-.alpha.-normuramyl-alanyl- N(5)-[5-[(1-nitro-9-acridinyl)amino]pentyl]-, stereoisomer NSC677599

pdb file: 517248.pdb
sdf file: 517248.sdf
directory: 517248

Geodiamolide A L-Alanine, N-[N-[N-(8-hydroxy-2,4,6-trimethyl-1-oxo-4- nonenyl)-L-alanyl]-3-iodo-N-methyl-D-tyrosyl]-, .pi.-lactone, [2S-(2R*,4E,6S*,8R*)]- NSC682308

pdb file: 519216.pdb
sdf file: 519216.sdf
directory: 519216

.alpha.-D-Glucopyranoside, phenylmethyl 2-acetylamino-2-deoxy- 3-O-[[2-[[2-[1-(aminocarbonyl)-4-[[5-[(1-nitro- 9-acridinyl)amino]pentyl]amino]-4-oxobutyl]amino]- 1-methyl-2-oxoethyl]amino]-1-methyl-2-oxoethyl]- Glutamamide, N-acetyl-1-O-(phenylmethyl)-.alpha.-muramoyl- alanyl-N(5)-[5-[(1-nitro-9-acridinyl)amino]pentyl]-,stereoisomer NSC683692

pdb file: 519933.pdb
sdf file: 519933.sdf
directory: 519933

D-phenylalanyl-L-hemicystyl-L-phenylalanyl-D-trytphyl-L- lysyl-L-threonyl-L-hemicystyl-L-threoninol cyclic (2-

pdb file: 520642.pdb
sdf file: 520642.sdf
directory: 520642

N-acetyl-1-benzyl-nor-muramyl-L-alanyl-D-isoglutamyl-N- .delta.-butylamino-N[4'-nitroacridone-9'(10H)] NSC697469

pdb file: 525496.pdb
sdf file: 525496.sdf
directory: 525496

NSC700252 meso-2,6-diaminopimelyl-(D)-methyl ester-(L)-L-alanyl-D-iso glutamyl-[N'-(2-aminoethyl)-2-aminoethyl]-4-nitro-9-aminoacridine, dihydrochloride

pdb file: 526867.pdb
sdf file: 526867.sdf
directory: 526867

NSC700253 meso-2,6-diaminopimely-(D)-methyl ester-(L)-L-alanyl-D-isogl utamyl-N-.gamma.-propylamino-N[4'-nitroacridone-9'(10)], di hydrochloride

pdb file: 526868.pdb
sdf file: 526868.sdf
directory: 526868

Cyclo(.alpha.S,2S)-.alpha.-amino-.eta.-oxooxiraneoctanoyl- L-phenylalanyl-L-phenylalanyl-D-prolyl] NSC700657 Trapoxin B

pdb file: 527124.pdb
sdf file: 527124.sdf
directory: 527124

1,7,13-Trioxa-4,10,16-triazacyclooctadecane, cyclic peptide deriv. Beauvericin Cyclo(D-.alpha.-hydroxyisovaleryl-N-methyl-L-phenylalanyl-D~ -.alpha.-hydroxyisovaleryl-N-methyl-L-phenylalanyl-D-.alpha.-hydroxyisovaleryl-N-methyl-L-phenylalanyl) NSC708472

pdb file: 529840.pdb
sdf file: 529840.sdf
directory: 529840

L-alanyl derivative of 2-(4-amino-3-methylphenyl)-5-fluorobenzothiazole (HCl salt) NSC711669

pdb file: 531399.pdb
sdf file: 531399.sdf
directory: 531399

N-acetyl-muramyl-1-O-benzyl-L-alanyl-D-(gama)-isoglutamyl-O-(gama)-propyl-4-carboxyamidoacridine NSC721177

pdb file: 535931.pdb
sdf file: 535931.sdf
directory: 535931

N-acetyl-nor-muramyl-1-O-benyl-L-alanyl-D-(gama)-isoglutamyl -O-(beta)-ethyl-4-carboxyamidoacridine NSC721179

pdb file: 535933.pdb
sdf file: 535933.sdf
directory: 535933

N-acetyl-nor-muramyl-1-O-benzyl-L-alanyl-D-(gama)-isoglutamy l-O-(beta)-ethyl-4-carboxyamidoacridone NSC721180

pdb file: 535934.pdb
sdf file: 535934.sdf
directory: 535934

3'-(L-.alpha.-Amino-p-methoxyhydrocinnamamido)-3'-deoxy-N,N-dimethyladenosine dihydrochloride 3123L, dihydrochloride 58-58-2 Adenosine, 3'-(.alpha.-amino-p-methoxyhydrocinnamamido)-3'-deoxy-N,N-dimethyl-, dihydrochloride Adenosine, 3'-(.alpha.-amino-p-methoxyhydrocinnamamido)-3'-deoxy-N,N-dimethyl-, dihydrochloride, L- Adenosine, 3'-[(2-amino-3-(4-methoxyphenyl)-1-oxopropyl]amino]-3'-deoxy-N,N-dimethyl-, dihydrochloride, (S)- Adenosine, 3'-[[2-amino-3-(4-methoxyphenyl)-1-oxopropyl]amino]-3'-deoxy-N,N-dimethyl-, dihydrochloride, (S)- CL 13,900 dihydrochloride CL 16,536 CL 16536 NSC3055 P 638 dihydrochloride PDH PUROMYCIN Purine, 6-dimethylamino-9-[3-(p-methoxy-L-phenylalanylamino)-3-deoxy-.beta.-D-ribofuranosyl]-, dihydrochloride Puromycin Dihydrochloride Puromycin hydrochloride Puromycin, dihydrochloride Stylomycin dihydrochloride X 185

pdb file: 538572.pdb
sdf file: 538572.sdf
directory: 538572

35959-68-3 Alanine, N-[3-(tritylthio)-L-alanyl]-, DL- NSC127920

pdb file: 557330.pdb
sdf file: 557330.sdf
directory: 557330

35959-70-7 NSC129156 Valine, N-[3-(tritylthio)-L-alanyl]-, methyl ester, monohydrochloride, L-

pdb file: 557459.pdb
sdf file: 557459.sdf
directory: 557459

10409-85-5 ISARIIN L-Valine, N-[N-[N-[N-[N-(3-hydroxy-1-oxododecyl)glycyl]-L-valyl]-D-leucyl]-L-alanyl]-, .rho.-lactone, (R)- NSC135015

pdb file: 558296.pdb
sdf file: 558296.sdf
directory: 558296

3577-89-7 ASALEY Asalex Ethyl ester of N-acetyl-DL-sarcolysyl-L-leucine L-Leucine, N-[N-acetyl-4-[bis(2-chloroethyl)amino]-DL-phenylalanyl]-, ethyl ester L-Leucine, N-[N-acetyl-4-[bis-(2-chloroethyl)amino]-DL-phenylalanyl]-, ethylester Leucine, N-[N-acetyl-3-[p-[bis(2-chloroethyl)amino]phenyl]-DL-alanyl]-, ethyl ester, L- NSC167780

pdb file: 562499.pdb
sdf file: 562499.sdf
directory: 562499

1393-48-2 Alaninamide, Alaninamide, N-[2-carboxy-7,8-dihydro-8-hydroxy-4-(1-hydroxyethyl)-7-quinolinyl]isoleucylalanyl-2,3-didehydroalanylalanyl-2-[4a-amino-21-(1,2-dihydroxy-1-methylpropyl)-14-ethylidene-3,4,4a,9,10,11,12,13,14,18,19,20,21,27,28,32a-hexadecahydro-11,28-bis(1-hydroxyethyl)-9,12,19,26-tetraoxo-17H,26H-8,5:18,15:25,22:32,29-tetranitrilo-5H,15H-pyrido[3,2-m][1,11,17,24,4,7,20,27]tetrathiatetraazacyclotriacontin-2-yl]-4-thiazolecarbonyl-2,3-didehydroalanyl-2,3-didehydro-, .alpha.1-lactone Bryamycin NSC 81722 NSC170365 THIOSTREPTON Thiactin

pdb file: 563007.pdb
sdf file: 563007.sdf
directory: 563007

20727-65-5 L-Aspartic acid, N-L-alanyl- NSC186912

pdb file: 564822.pdb
sdf file: 564822.sdf
directory: 564822

L-Threonine, N-L-alanyl- NSC186914

pdb file: 564823.pdb
sdf file: 564823.sdf
directory: 564823

70448-42-9 L-Leucine, N-[N-acetyl-4-[bis(2-chloroethyl)amino]-D-phenylalanyl]-, ethyl ester NSC220304

pdb file: 566894.pdb
sdf file: 566894.sdf
directory: 566894

16753-43-8 L-Leucine, N-[N-acetyl-4-[bis(2-chloroethyl)amino]-L-phenylalanyl]-, ethyl ester NSC220305

pdb file: 566895.pdb
sdf file: 566895.sdf
directory: 566895

18H-Dipyrrolo[2,1-c:2',1'-o][1,4,7,10,13,16,19,22,25]oxaoctaazacyclooctacosine 19246-24-3 A-128 Antibiotic 128 L-Proline, L-.beta.-aspartyl-L-seryl-L-threonyl-L-allothreonyl-L-alanylglycyl-trans-3-hydroxy-L-prolyl-erythro-3-hydroxy-L-leucyl-.beta.-methyl-L-tryptophyl-.alpha.,.beta.-didehydro-L-tryptophyl-cis-3-hydroxy-, .beta.1-lactone NSC235069 TELOMYCIN

pdb file: 567701.pdb
sdf file: 567701.sdf
directory: 567701

.beta.-Alanine, N-[N-[N-[N-[1-(D-2-hydroxy-4-methyl-1-oxopentyl)-L-prolyl]-L-isoleucyl]-N-methyl-L-valyl]-N-methyl-L-alanyl]-, .rho.-lactone 2503-26-6 DESTRUXIN B NSC236580

pdb file: 567759.pdb
sdf file: 567759.sdf
directory: 567759

13331-69-6 L-Phenylalanine, N-(N-acetyl-D-alanyl)-4-[bis(2-chloroethyl)amino]-, ethyl ester NSC240742

pdb file: 568098.pdb
sdf file: 568098.sdf
directory: 568098

L-Phenylalanine, 4-[bis(2-chloroethyl)amino]-N-[N-[N-(N-L-prolylglycyl)-L-valyl]-L-phenylalanyl]-, ethyl ester, dihydrochloride L-Phenylalanine, 4-[bis(2-chloroethyl)amino]-N-[N-[N-[N-(N-L-prolylglycyl)-L-valyl]-L-phenylalanyl]-, ethyl ester, dihydrochloride NSC241272

pdb file: 568194.pdb
sdf file: 568194.sdf
directory: 568194

(S)-Cyclic(D-alanyl-L-alanyl-N,O-dimethyl-L-tyrosyl-L-alanyl-.beta.-hydroxy-N-methyl-L-tyrosyl-3-hydroxy-N-methyl-L-tyrosyl) cyclic (54.fwdarw.63)-ether 22-Oxa-3,6,9,12,15,29-hexaazatetracyclo[,2-1.123,27]tritriacontane, cyclic peptide deriv. 64755-14-2 BOUVARDIN Cyclic(D-alanyl-L-alanyl-N,O-dimethyl-L-tyrosyl-L-alanyl-.beta.-hydroxy-N-methyl-L-tyrosyl-3-hydroxy-N-methyl-L-tyrosyl), cyclic(54.fwdarw.63)-ether, (S)- From fraction F049 of Bouvardia ternifolia NSC 259968 NSC259968

pdb file: 569465.pdb
sdf file: 569465.sdf
directory: 569465

6754-85-4 Asaley acid L-Leucine, N-[N-acetyl-4-[bis(2-chloroethyl)amino]-DL-phenylalanyl]- Leucine, N-[N-acetyl-3-[p-[bis(2-chloroethyl)amino]phenyl]-DL-alanyl]-, L- NSC261105

pdb file: 569523.pdb
sdf file: 569523.sdf
directory: 569523

66919-95-7 L-Leucine, N-[4-[bis(2-chloroethyl)amino]-L-phenylalanyl]- NSC262193

pdb file: 569570.pdb
sdf file: 569570.sdf
directory: 569570

66919-98-0 L-Leucine, N-[4-[bis(2-chloroethyl)amino]-D-phenylalanyl]- NSC262194

pdb file: 569571.pdb
sdf file: 569571.sdf
directory: 569571

18705-85-6 L-Valine, N-[N-Acetyl-4-[bis(2-chloroethyl)amino]-D-phenylalanyl]-, ethyl ester NSC264494

pdb file: 569724.pdb
sdf file: 569724.sdf
directory: 569724

L-Leucine, N-[4-[bis(2-chloroethyl)amino]-DL-phenylalanyl]-, ester, hydrochloride (2:3) L-Leucine, N-[4-[bis(2-chloroethyl)amino]-DL-phenylalanyl]-, ethyl ester, hydrochloride (2:3) NSC266068

pdb file: 569881.pdb
sdf file: 569881.sdf
directory: 569881

26305-03-3 Heptanoic acid, N-(3-methyl-1-oxobutyl)-L-valyl-L-valyl-4-amino-3-hydroxy-6-methylheptanoyl-L-alanyl-4-amino-3-hydroxy-6-methyl- N-(3-methyl-1-oxobutyl)-L-valyl-L-valyl-4-amino-3-hydroxy-6-methylheptanoyl-L-alanyl-4-amino-3-hydroxy-6-methylheptanoic acid NSC272671 PEPSTATIN Pepstatin A

pdb file: 570552.pdb
sdf file: 570552.sdf
directory: 570552

NSC352378 Phenylalanine, N-(N-acetyl-4-aminophenylalanyl)-4-[bis(2-chloroethyl)amino]-, ethyl ester, hydrochloride (10:16)

pdb file: 576157.pdb
sdf file: 576157.sdf
directory: 576157

NSC352379 Phenylalanine, N-(N-acetyl-4-aminophenylalanyl)-4-[bis(2-chloroethyl)amino]-, ethyl ester, hydrochloride (10:17), isomer B

pdb file: 576158.pdb
sdf file: 576158.sdf
directory: 576158


pdb file: 576294.pdb
sdf file: 576294.sdf
directory: 576294

.beta.-Alaninamide, cis-4-methyl-1-(4-methyl-1-oxo-2-hexenyl)- L-prolyl-(4S,6S)-6-hydroxy-4-methyl-8-oxo- L-2-aminodecanoyl-threo-3-hydroxy-L-leucyl- 2-methylalanyl-L-leucyl-L-leucyl-2-methylalanyl- 2-methylalanyl-N-[2-(dimethylamino)-1-methylethyl]-, [1[S-(E)],9(S)]- 76600-38-9 Antibiotic 1907-VIII Antibiotic CC 1014 Antibiotic P 168 Leucinostatin A NSC356885

pdb file: 576440.pdb
sdf file: 576440.sdf
directory: 576440

17466-45-4 Cyclic(L-alanyl-D-threonyl-L-cysteinyl-cis-4-hydroxy-L-prolyl-L-alanyl-2-mercapto-L-tryptophyl-4,5-dihydroxy-L-leucyl), cyclic (3.fwdarw.6)-sulfide NSC523214 Phalloidin Phalloidine

pdb file: 580061.pdb
sdf file: 580061.sdf
directory: 580061

3'-N-(L-.alpha.-alanyl)-daunorubicine NSC600878

pdb file: 580486.pdb
sdf file: 580486.sdf
directory: 580486

3'-N-(.beta.-alanyl)-daunorubicine NSC600879

pdb file: 580487.pdb
sdf file: 580487.sdf
directory: 580487

1,2-Benzo-8-(L-alanyl)-3-phenoxazone nitrate salt NSC672425

pdb file: 582077.pdb
sdf file: 582077.sdf
directory: 582077

1,2-Benzo-8-(D-alanyl)-3-phenoxazone nitrate NSC672426

pdb file: 582078.pdb
sdf file: 582078.sdf
directory: 582078

N-acetyl-nor-muramyl-1-O-benzyl-L-alanyl-D-(gama)-isoglutamy l-O-(gama)-propyl-4-carboxyamidoacridone NSC721181

pdb file: 582539.pdb
sdf file: 582539.sdf
directory: 582539

2-(2-Butyrylamino-propionylamino)-N-[5-(3-chloro-4-hydroxy-benzyl)-21-hydroxy-2-(1-hydroxy-ethyl)-15-isobutyl-8-isopropyl-4,11-dimethyl-3,6,9,13,16,22-hexaoxo-10-oxa-1,4,7,14,17-pentaaza-bicyclo[16.3.1]docos-12-yl]-3-hydroxy-butyramide InChI=1/C45H69ClN8O14/c1-11-12-32(58)47-22(6)38(60)51-35(23(7)55)41(63)52-36-25(9)68-45(67)34(21(4)5)50-40(62)30(19-26-13-15-31(57)27(46)18-26)53(10)44(66)37(24(8)56)54-33(59)16-14-28(43(54)65)48-39(61)29(17-20(2)3)49-42(36)64/h13,15,18,20-25,28-30,33-3 L-allothreoninamide, N-(1-oxobutyl)-L-alanyl-N-[(2S,5S,8S,12S,15S,18R,21S)-5-[(3-chloro-4-hydroxyphenyl)methyl]-21-hydroxy-2-[(1S)-1-hydroxyethyl]-4,11-dimethyl-8-(1-methylethyl)-15-(2-methylpropyl)-3 N-butyryl-D-alanyl-rel-N-{(2R,5R,8R,12R,15R,18S,21R)-5-(3-chloro-4-hydroxybenzyl)-21-hydroxy-2-[(1R)-1-hydroxyethyl]-15-isobutyl-8-isopropyl-4,11-dimethyl-3,6,9,13,16,22-hexaoxo-10-oxa-1,4,7,14,17-pen Scyptolin A

pdb file: 585379.pdb
sdf file: 585379.sdf
directory: 585379

2(5H)-furanone, 5-[(2S,6Z,8E)-2,6-dimethyl-9-[(7S)-4,5,6,7-tetrahydro-7-methyl-7-benzofuranyl]-6,8-nonadienylidene]-4-hydroxy-3-methyl-, (5Z)- 6-Benzyl-21-(1-hydroxy-ethyl)-15-(1H-indol-3-ylmethyl)-18-isobutyl-1,4,7,13,16,19,22-heptaaza-tricyclo[^(9,13)]heptacosane-2,5,8,14,17,20,23-heptaone InChI=1/C42H54N8O8/c1-24(2)19-30-38(54)47-32(21-27-22-43-29-14-8-7-13-28(27)29)42(58)50-18-10-16-34(50)39(55)45-31(20-26-11-5-4-6-12-26)37(53)44-23-35(52)49-17-9-15-33(49)40(56)48-36(25(3)51)41(57)46-30/h4-8,11-14,22,24-25,30-34,36,43,51H,9-10,15-21,23H Phakellistatin 13 cyclo(glycyl-D-prolyl-D-threonyl-D-leucyltryptophyl-D-prolyl-rel-D-phenylalanyl) cyclo-(Pro-Trp-Leu-Thr-Pro-Gly-Phe)

pdb file: 586095.pdb
sdf file: 586095.sdf
directory: 586095

1-[2-({2-[2-(4-Carbamoyl-2-{[2-(2-hydroxy-3-methyl-pentanoylamino)-4-methyl-pentanoyl]-methyl-amino}-butyrylamino)-3-methyl-pentanoylamino]-acetyl}-methyl-amino)-3-phenyl-propionyl]-pyrrolidine-2-carboxylic acid methyl ester InChI=1/C42H67N7O10/c1-10-26(5)35(46-37(53)30(19-20-33(43)50)48(8)40(56)29(22-25(3)4)45-39(55)36(52)27(6)11-2)38(54)44-24-34(51)47(7)32(23-28-16-13-12-14-17-28)41(57)49-21-15-18-31(49)42(58)59-9/h12-14,16-17,25-27,29-32,35-36,52H,10-11,15,18-24H2,1-9H3, L-proline, N-[(2S)-2-hydroxy-3-methyl-1-oxopentyl]-L-leucyl-N~2~-methyl-L-glutaminyl-L-isoleucylglycyl-N-methyl-D-phenylalanyl-, methyl ester Tasiamide methyl N-[(2R,3R)-2-hydroxy-3-methylpentanoyl]-D-leucyl-N~2~-methyl-D-glutaminyl-D-isoleucylglycyl-N-methyl-L-phenylalanyl-rel-D-prolinate

pdb file: 586483.pdb
sdf file: 586483.sdf
directory: 586483

D,L-ALANINE,BETA-ALANYL,N-PHENOXYCARBONYL InChI=1/C13H16N2O5/c1-9(12(17)18)15-11(16)7-8-14-13(19)20-10-5-3-2-4-6-10/h2-6,9H,7-8H2,1H3,(H,14,19)(H,15,16)(H,17,18 N-(phenoxycarbonyl)-beta-alanylalanine alanine, N-(phenoxycarbonyl)-beta-alanyl-

pdb file: 587103.pdb
sdf file: 587103.sdf
directory: 587103

D,L-ALANINE,GLYCYL,N-PHENOXYCARBONYL,BETA-ALANYL InChI=1/C15H19N3O6/c1-10(14(21)22)18-13(20)9-17-12(19)7-8-16-15(23)24-11-5-3-2-4-6-11/h2-6,10H,7-9H2,1H3,(H,16,23)(H,17,19)(H,18,20)(H,21,22 N-(phenoxycarbonyl)-beta-alanylglycylalanine alanine, N-(phenoxycarbonyl)-beta-alanylglycyl-

pdb file: 587104.pdb
sdf file: 587104.sdf
directory: 587104

InChI=1/C21H24N2O5/c1-15(20(25)27-2)22-19(24)18(13-16-9-5-3-6-10-16)23-21(26)28-14-17-11-7-4-8-12-17/h3-12,15,18H,13-14H2,1-2H3,(H,22,24)(H,23,26 L ALANINE,N-BENZYLOXYCARBONYL,L-PHENYLALANYL),METHYL ESTER alanine, N-[(phenylmethoxy)carbonyl]phenylalanyl-, methyl ester methyl N-[(benzyloxy)carbonyl]phenylalanylalaninate

pdb file: 587125.pdb
sdf file: 587125.sdf
directory: 587125

InChI=1/C17H24N2O5/c1-17(2,3)24-16(22)19-13(10-12-8-6-5-7-9-12)15(21)18-11-14(20)23-4/h5-9,13H,10-11H2,1-4H3,(H,18,21)(H,19,22 L-PHENYLALANINEGLYCINE,(TERT.BUTYLOXYCARBONYL),METHYL ESTER glycine, N-[(1,1-dimethylethoxy)carbonyl]phenylalanyl-, methyl ester methyl N-(tert-butoxycarbonyl)phenylalanylglycinate

pdb file: 587135.pdb
sdf file: 587135.sdf
directory: 587135

94202-58-1 InChI=1/C24H30N2O5/c1-24(2,3)31-23(29)26-19(15-17-11-7-5-8-12-17)21(27)25-20(22(28)30-4)16-18-13-9-6-10-14-18/h5-14,19-20H,15-16H2,1-4H3,(H,25,27)(H,26,29 L-PHENYLALANINE,N-(TERT.BUTYLOXYCARBONYL,L-PHENYLALANYL), METHYL ESTER methyl N-(tert-butoxycarbonyl)phenylalanylphenylalaninate phenylalanine, N-[(1,1-dimethylethoxy)carbonyl]phenylalanyl-, methyl ester

pdb file: 587141.pdb
sdf file: 587141.sdf
directory: 587141

InChI=1/C4H4ClNO2/c5-4(8)1-2-6-3-7/h1-2H N-(oxomethylene)-beta-alanyl chloride PROPANOIC ACID,3-ISOCYANATO,CHLORIDE propanoyl chloride, 3-isocyanato-

pdb file: 587205.pdb
sdf file: 587205.sdf
directory: 587205

InChI=1/C19H26N4O5S/c1-19(2,3)28-18(26)23-14(9-13-6-5-7-29-13)16(24)22-15(17(25)27-4)8-12-10-20-11-21-12/h5-7,10-11,14-15H,8-9H2,1-4H3,(H,20,21)(H,22,24)(H,23,26 histidine, N-[(1,1-dimethylethoxy)carbonyl]-3-(2-thienyl)alanyl-, methyl ester methyl N-(tert-butoxycarbonyl)-3-(2-thienyl)alanylhistidinate

pdb file: 589371.pdb
sdf file: 589371.sdf
directory: 589371

InChI=1/C44H63N9O14/c1-24(2)21-30(50-37(59)26(45)22-25-9-4-3-5-10-25)42(64)51-18-6-11-31(51)40(62)47-27(14-16-35(55)56)38(60)49-29(23-34(46)54)39(61)48-28(15-17-36(57)58)41(63)52-19-7-12-32(52)43(65)53-20-8-13-33(53)44(66)67/h3-5,9-10,24,26-33H,6-8,11-2 phenylalanylleucylprolyl-alpha-glutamylasparaginyl-alpha-glutamylprolylproline proline, phenylalanylleucylprolyl-alpha-glutamylasparaginyl-alpha-glutamylprolyl-

pdb file: 590782.pdb
sdf file: 590782.sdf
directory: 590782

2-[2-(2-carboxyethoxy)ethoxy]ethyl N-acetyltyrosylseryltyrosylphenylalanylprolylserylvalinate InChI=1/C52H69N7O17/c1-31(2)45(52(73)76-25-24-75-23-22-74-21-19-44(65)66)58-49(70)42(30-61)57-50(71)43-10-7-20-59(43)51(72)40(28-33-8-5-4-6-9-33)55-47(68)39(27-35-13-17-37(64)18-14-35)54-48(69)41(29-60)56-46(67)38(53-32(3)62)26-34-11-15-36(63)16-12-34/h valine, N-acetyltyrosylseryltyrosylphenylalanylprolylseryl-, 2-[2-(2-carboxyethoxy)ethoxy]ethyl ester

pdb file: 590787.pdb
sdf file: 590787.sdf
directory: 590787

InChI=1/C28H36N4O8/c1-16(2)12-22(27(37)38)32-26(36)21(14-17-6-4-3-5-7-17)30-24(34)15-23(28(39)40)31-25(35)20(29)13-18-8-10-19(33)11-9-18/h3-11,16,20-23,33H,12-15,29H2,1-2H3,(H,30,34)(H,31,35)(H,32,36)(H,37,38)(H,39,40 leucine, tyrosyl-beta-aspartylphenylalanyl- tyrosyl-beta-aspartylphenylalanylleucine

pdb file: 590906.pdb
sdf file: 590906.sdf
directory: 590906

InChI=1/C28H36N4O8/c1-16(2)12-23(28(39)40)32-26(37)21(14-17-6-4-3-5-7-17)31-27(38)22(15-24(34)35)30-25(36)20(29)13-18-8-10-19(33)11-9-18/h3-11,16,20-23,33H,12-15,29H2,1-2H3,(H,30,36)(H,31,38)(H,32,37)(H,34,35)(H,39,40 leucine, tyrosyl-alpha-aspartylphenylalanyl- tyrosyl-alpha-aspartylphenylalanylleucine

pdb file: 590907.pdb
sdf file: 590907.sdf
directory: 590907

InChI=1/C21H38N6O7/c1-6-10(3)16(20(32)27-17(21(33)34)11(4)7-2)26-15(29)9-24-19(31)13(8-14(23)28)25-18(30)12(5)22/h10-13,16-17H,6-9,22H2,1-5H3,(H2,23,28)(H,24,31)(H,25,30)(H,26,29)(H,27,32)(H,33,34 alanylasparaginylglycylisoleucylisoleucine isoleucine, alanylasparaginylglycylisoleucyl-

pdb file: 591062.pdb
sdf file: 591062.sdf
directory: 591062

InChI=1/C13H24N2O4/c1-5-10-18-11(16)14-8-6-7-9-15-12(17)19-13(2,3)4/h5H,1,6-10H2,2-4H3,(H,14,16)(H,15,17 allyl tert-butyl butane-1,4-diylbiscarbamate prolinamide, N-acetylphenylalanylleucylprolyl-alpha-glutamylthreonyl-alpha-glutamyl-N-2-propenyl-

pdb file: 591160.pdb
sdf file: 591160.sdf
directory: 591160

InChI=1/C44H64N8O13/c1-6-20-45-40(61)33-14-10-21-51(33)43(64)30(17-19-36(57)58)48-42(63)37(26(4)53)50-38(59)29(16-18-35(55)56)47-41(62)34-15-11-22-52(34)44(65)32(23-25(2)3)49-39(60)31(46-27(5)54)24-28-12-8-7-9-13-28/h6-9,12-13,25-26,29-34,37,53H,1,10-11 N-acetylphenylalanylleucylprolyl-alpha-glutamylthreonyl-alpha-glutamyl-N-allylprolinamide prolinamide, N-acetylphenylalanylleucylprolyl-alpha-glutamylthreonyl-alpha-glutamyl-N-2-propenyl-

pdb file: 591161.pdb
sdf file: 591161.sdf
directory: 591161

InChI=1/C46H63N7O10S/c1-26(2)22-34(42(56)50-36(44(58)59)24-30-25-53(45(60)63-46(7,8)9)38-19-13-12-16-31(30)38)49-41(55)29(6)47-40(54)28(5)48-43(57)35(23-27(3)4)51-64(61,62)39-21-15-17-32-33(39)18-14-20-37(32)52(10)11/h12-21,25-29,34-36,51H,22-24H2,1-11H N-{[5-(dimethylamino)-1-naphthyl]sulfonyl}leucylalanylalanylleucyl-1-(tert-butoxycarbonyl)tryptophan tryptophan, N-[[5-(dimethylamino)-1-naphthalenyl]sulfonyl]leucylalanylalanylleucyl-1-[(1,1-dimethylethoxy)carbonyl]-

pdb file: 591218.pdb
sdf file: 591218.sdf
directory: 591218

InChI=1/C27H34N2O5/c1-16(2)23(25(31)34-27(4,5)6)29-24(30)17(3)28-26(32)33-15-22-20-13-9-7-11-18(20)19-12-8-10-14-21(19)22/h7-14,16-17,22-23H,15H2,1-6H3,(H,28,32)(H,29,30 tert-butyl N-[(9H-fluoren-9-ylmethoxy)carbonyl]alanylvalinate valine, N-[(9H-fluoren-9-ylmethoxy)carbonyl]alanyl-, 1,1-dimethylethyl ester

pdb file: 591281.pdb
sdf file: 591281.sdf
directory: 591281

1H-pyrrole-2-carboxamide, 4-[[3-[[(9,10-dihydro-9,10-dioxo-2-anthracenyl)carbonyl]amino]-1-oxopropyl]amino]-N-[3-(dimethylamino)propyl]-1-methyl- InChI=1/C29H31N5O5/c1-33(2)14-6-12-30-29(39)24-16-19(17-34(24)3)32-25(35)11-13-31-28(38)18-9-10-22-23(15-18)27(37)21-8-5-4-7-20(21)26(22)36/h4-5,7-10,15-17H,6,11-14H2,1-3H3,(H,30,39)(H,31,38)(H,32,35 N-[3-(dimethylamino)propyl]-4-({N-[(9,10-dioxo-9,10-dihydroanthracen-2-yl)carbonyl]-beta-alanyl}amino)-1-methyl-1H-pyrrole-2-carboxamide N-[3-(dimethylamino)propyl]-4-[(3-{[9,10-dioxo-9,10dihydro-2-anthracenyl)carbonyl]amino}-propanoyl]amino]-1-methyl-1H-pyrrole-2-carboxamide

pdb file: 593372.pdb
sdf file: 593372.sdf
directory: 593372

59865-13-3 AIDS-000146 AIDS000146 CSA Ciclosporin Cyclo[[(E)-(2S,3R,4R)-3-hydroxy-4-methyl-2-(methylamino)-6-octenoyl]-L-2-aminobutyryl-N-methylglycyl-N-methyl-L-leucyl-L-valyl-N-methyl-L-leucyl-L-alanyl-D-alanyl-N-methyl-L-leucyl-N-methyl-L-leucyl-N-methyl-L-valyl] Cyclosporin A Cyclosporine NSC290193 Neoplanta Ramihyphin A Sandimmune Sang-35

pdb file: 594850.pdb
sdf file: 594850.sdf
directory: 594850

83461-56-7 AIDS-000184 AIDS000184 CGP 19835A L-Alaninamide, N-(N-acetylmuramoyl)-L-alanyl-D-.alpha.-glutaminyl-N-[(7R)-4-hydroxy-4-oxido-10-oxo-7-[(1-oxohexadecyl)oxy]-3,5,9-trioxa-4-phosphapentacos-1-yl]- MTP-PE Muramyl tripeptide N-Acetyl-muramyl-L-alanyl-D-isoglutaminyl-L-alanine-(1'-2'-dipalmitoyl-sn-glycero-3'-hydroxy-phosphoryl-oxy)-ethanolamine

pdb file: 594888.pdb
sdf file: 594888.sdf
directory: 594888

26305-03-3 AIDS-000247 AIDS000247 Iva-Val-Val-Sta-Ala-Sta-OH N-[(3-Methyl-1-oxobutyl)-L-valyl-L-valyl-4-amino-3-hydroxy-6-methylheptanoyl-L-alanyl]-4-amino-3-hydroxy-6-methylheptanoic acid NSC272671 Pepstatin Pepstatin A Pepstatine

pdb file: 594930.pdb
sdf file: 594930.sdf
directory: 594930

126333-28-6 5-(Ala-Ala) Val-Val-OMe deriv. 5-(L-Alanyl-L-alanylamino)-4-hydroxy-6-phenylhexanoic acid, methyl valyl-valyl amide AIDS-000504 AIDS000504 Ala-Ala-Phe.psi.[CH(OH)CH2]Gly-Val-Val-OCH3 Hydroxyethylene isostere analog(AA-II-VV-OMe) L-Valine, L-alanyl-L-alanyl-(.gamma.S, .delta.S), methyl ester SKF 107457

pdb file: 595145.pdb
sdf file: 595145.sdf
directory: 595145

126380-03-8 AIDS-000505 AIDS000505 Cbz-Ala-Ala-Phe.psi.[CH(OH)CH2]Gly-Val-Val-OCH3 L-Valine, N-[(phenylmethoxy)carbonyl]-L-alanyl-L-alanyl-(gS,dS), methyl ester Methyl (2S)-2-{(2S)-2-[5-((2S)-2-{(2S)-2-[(phenylmethoxy)carbonylamino]propanoylamino}propanoylamino)(4S,5S)-4-hydroxy-6-phenylhexanoylamino]-3-methylbutanoylamino}-3-methylbutanoate SKF 107461

pdb file: 595146.pdb
sdf file: 595146.sdf
directory: 595146

126380-04-9 AIDS-000506 AIDS000506 Boc-Ser-Ala-Ala-Tyr.psi.[CH(OH)CH2]Gly-Val-Val-OCH3 L-Valine, N-[N-[5-[[N-[N-[N-[(1,1-dimethylethoxy)carbonyl]-L-seryl]-L-alanyl]-L-alanyl]amino]-4-hydroxy-6-(4-hydroxyphenyl)-1-oxohexyl]-L-valyl]-, methyl ester, [S-(R*,R*)]-

pdb file: 595147.pdb
sdf file: 595147.sdf
directory: 595147

AIDS-000555 AIDS000555 L-Valine, N-[N-[2,4,5-trideoxy-5-phenyl-4-[[N-(N-L-seryl-L-alanyl)-L-alanyl]amino]-L-threo-pentonoyl]-L-valyl]-, methyl ester SAA-I-VV-OMe Statine analog Statine analog (SAA-I-VV-OMe)

pdb file: 595194.pdb
sdf file: 595194.sdf
directory: 595194

126380-76-5 AIDS-000556 AIDS000556 Hydroxyethylene isoster analog(SAA-II-VV-OMe) L-Valine, N-[N-[4-hydroxy-1-oxo-6-phenyl-5-[[N-(N-L-seryl-L-alanyl)-L-alanyl]amino]hexyl]-L-valyl]-, methyl ester, [S-(R*,R*)]- SAA-II-VV-OMe

pdb file: 595195.pdb
sdf file: 595195.sdf
directory: 595195

126380-77-6 AIDS-000558 AIDS000558 Hydroxyethylene isoester analog(SAA-III-VV-OMe) L-Valine, N-[N-[4-hydroxy-6-(4-hydroxyphenyl)-1-oxo-5-[[N-(N-L-seryl-L-alanyl)-L-alanyl]amino]hexyl]-L-valyl]-, methyl ester, [S-(R*,R*)]- SAA-III-VV-OMe

pdb file: 595197.pdb
sdf file: 595197.sdf
directory: 595197

126455-01-4 AIDS-000559 AIDS000559 Hydroxyethylene isoester analog(SAA-4-VV-OMe) L-Valine, N-[N-[4-hydroxy-1-oxo-6-phenyl-5-[[N-(N-L-seryl-L-alanyl)-L-alanyl]amino]hexyl]-L-valyl]-, methyl ester, [R-(R*,S*)]- SAA-4-VV-OMe

pdb file: 595198.pdb
sdf file: 595198.sdf
directory: 595198

126333-29-7 AIDS-000561 AIDS000561 Hydroxyethylene isostere analog(SAA-5-VV-OMe) L-Valine, L-seryl-L-alanyl-L-alanyl-(1R,2R)-2-[(1S,2S)-2-amino-1-hydroxy-3-phenylpropyl]cyclopentanecarbonyl-L-valyl-, methyl ester L-Valine, N-[N-[[2-[1-hydroxy-3-phenyl-2-[[N-(N-L-seryl-L-alanyl)-L-alanyl]amino]propyl]cyclopentyl]carbonyl]-L-valyl]-, methyl ester, [1R-[1a,2b(1S*,2S*)]]- SAA-5-VV-OMe

pdb file: 595200.pdb
sdf file: 595200.sdf
directory: 595200

126453-25-6 AIDS-000562 AIDS000562 Hydroxyethylene isostere analog(SAA-6-VV-OMe) L-Valine, N-[N-[[2-[1-hydroxy-3-phenyl-2-[[N-(N-L-seryl-L-alanyl)-L-alanyl]amino]propyl]cyclopentyl]carbonyl]-L-valyl]-, methyl ester, [1R-[1a,2b(1R*,2S*) SAA-6-VV-OMe

pdb file: 595201.pdb
sdf file: 595201.sdf
directory: 595201

126333-30-0 AIDS-000563 AIDS000563 Boc-SAA-7-VV-OMe Hydroxyethylene isostere analog(Boc-SAA-7-VV-OMe) L-Valine, N-[N-[[2-[2-[[N-[N-[N-[(1,1-dimethylethoxy)carbonyl]-L-seryl]-L-alanyl]-L-alanyl]amino]-1-hydroxy-3-phenylpropyl]cyclopentyl]carbonyl]-L-valyl]-, methyl ester, [1S-[1a,2b(1S*,2R*)]]-

pdb file: 595202.pdb
sdf file: 595202.sdf
directory: 595202

127470-77-3 AIDS-000564 AIDS000564 Boc-SAA-8-VV-OMe Hydroxyethylene isostere analog(Boc-SAA-8-VV-OMe) L-Valine, N-[N-[[2-[2-[[N-[N-[N-[(1,1-dimethylethoxy)carbonyl]-L-seryl]-L-alanyl]-L-alanyl]amino]-1-hydroxy-3-phenylpropyl]cyclopentyl]carbonyl]-L-valyl]-, methyl ester, [1S-[1a,2b(1R*,2R*)]]-

pdb file: 595203.pdb
sdf file: 595203.sdf
directory: 595203

126333-32-2 AIDS-000565 AIDS000565 Ac-SAA-9-VV-NH2 L-Valinamide, 1-[2-[[N-[N-(N-acetyl-L-seryl)-L-alanyl]-L-alanyl]amino]-3-phenylpropyl]-L-prolyl-L-valyl-, (S)- Reduced amidine isostere analog(Ac-SAA-IX-VV-NH2)

pdb file: 595204.pdb
sdf file: 595204.sdf
directory: 595204

126380-78-7 AIDS-000566 AIDS000566 L-Valinamide, 1-[3-phenyl-2-[[N-(N-L-seryl-L-alanyl)-L-alanyl]amino]propyl]-L-prolyl-L-valyl-, (S)- Reduced amide isostere analog(SAA-IX-VV-NH2) SAA-9-VV-NH2

pdb file: 595205.pdb
sdf file: 595205.sdf
directory: 595205

126333-33-3 AIDS-000567 AIDS000567 L-Valine, N-[N-[[hydroxy[2-phenyl-1-[[N-(N-L-seryl-L-alanyl)-L-alanyl]amino]ethyl]phosphinyl]acetyl]-L-valyl]-, methyl ester, (R)- Phosphinic acid analog(SAA-X-VV-OMe) SAA-10-VV-OMe

pdb file: 595206.pdb
sdf file: 595206.sdf
directory: 595206

126333-34-4 AIDS-000568 AIDS000568 L-Valine, N-[N-[3-[hydroxy[2-phenyl-1-[[N-(N-L-seryl-L-alanyl)-L-alanyl]amino]ethyl]phosphinyl]-1-oxopropyl]-L-valyl]-, methyl ester, (R)- Phosphinic acid analog(SAA-XI-VV-OMe) SAA-11-VV-OMe

pdb file: 595207.pdb
sdf file: 595207.sdf
directory: 595207

126333-35-5 AIDS-000569 AIDS000569 L-Valine, N-[N-[[2-[hydroxy[2-phenyl-1-[[N-(N-L-seryl-L-alanyl)-L-alanyl]amino]ethyl]phosphinyl]cyclopentyl]carbonyl]-L-valyl]-, methyl ester Phosphinic acid analog(SAA-XII-VV-OMe) SAA-12-VV-OMe

pdb file: 595208.pdb
sdf file: 595208.sdf
directory: 595208

126333-36-6 AIDS-000570 AIDS000570 Boc-SAA-13-VV-OMe Boc-Ser-Ala-Ala-(4S)-4-amino-2,2-difluoro-3-oxo-5-phenylpentanoyl-Val-Val-O-methyl ester Difluorostatone analog(Boc-SAA-XIII-VV-OMe) Difluorostatone deriv. L-Valine, N-[N-[4-[[N-[N-[N-[(1,1-dimethylethoxy)carbonyl]-L-seryl]-L-alanyl]-L-alanyl]amino]-2,2-difluoro-1,3-dioxo-5-phenylpentyl]-L-valyl]-, methyl ester, (S)-

pdb file: 595209.pdb
sdf file: 595209.sdf
directory: 595209

87420-48-2 AIDS-000688 AIDS000688 D-.alpha.-Glutamine, N2-[N-(N-acetyl-.beta.-allo-muramoyl)-L-alanyl]- MDP N-Acetylmuramyl-L-alanyl-D-isoglutamine

pdb file: 595295.pdb
sdf file: 595295.sdf
directory: 595295

1-[BenzyloxycarbonylcyanoalanyldecarbonylPhe(hydroxyethyl)]-2-(N-tertbutylcarbamoyl)piperidine 127749-98-8 AIDS-000708 AIDS000708 BzOC(CNAla)Phe[CHOHCH2]PipCONHtBu Carbamic acid, [1-(cyanomethyl)-2-[[3-[2-[[(1,1-dimethylethyl)amino]carbonyl]-1-piperidinyl]-2-hydroxy-1-(phenylmethyl)propyl]amino]-2-oxoethyl]-, phenylmethyl ester, [2S-[1[1R*(R*),2S*],2R*]]-

pdb file: 595315.pdb
sdf file: 595315.sdf
directory: 595315

53678-77-6 AIDS-000724 AIDS000724 D-.alpha.-Glutamine, N-(N-acetylmuramoyl)-L-alanyl- Muramyl dipeptide N-Acetyl-muramyl-L-alanyl-D-isoglutamine

pdb file: 595331.pdb
sdf file: 595331.sdf
directory: 595331

125780-80-5 (TRIFLUORACETIC ACID SALT) 5'-Phenylalanyl-3'-azido-3'-deoxythymidine AIDS-000744 AIDS000744 TFAc-phenylalanyl-AZT

pdb file: 595349.pdb
sdf file: 595349.sdf
directory: 595349

126347-55-5 AIDS-000748 AIDS000748 GIKQLQARILQVERYKDQQ Gly-Ile-Lys-Gln-leu-Gln-Ala-Arg-Ile-leu-Ala-Val-Glu-Arg-Tyr-Lys-Asp-Gln-Gln L-Glutamine, glycyl-L-isoleucyl-L-lysyl-L-glutaminyl-L-leucyl-L-glutaminyl-L-alanyl-L-arginyl-L-isoleucyl-L-leucyl-L-alanyl-L-valyl-L-.alpha.-glutamyl-L-arginyl-L-tyrosyl-L-lysyl-L-.alpha.-aspartyl-L-glutaminyl-

pdb file: 595353.pdb
sdf file: 595353.sdf
directory: 595353

(S)-2-{(2S,3S)-2-[(S)-2-((2RS,3S)-3-tert-Butoxycarbonylamino-2-hydroxy-4-phenyl-butylamino)-3-phenyl-propanoylamino]-3-methyl-pentanoylamino}-3-phenyl-propionic acid, methyl ester 215511-56-1 AIDS-000855 AIDS000855 Boc-Phe-[CHOHCH2]Phe-Ile-Phe-OMe L-Phenylalanine, N-[3-[[(1,1-dimethylethoxy)carbonyl]amino]-2-hydroxy-4-phenylbutyl]-L-phenylalanyl-L-alloisoleucyl-, methyl ester

pdb file: 595422.pdb
sdf file: 595422.sdf
directory: 595422

134527-87-0 AIDS-000857 AIDS000857 L-Histidinamide, N-[(1,1-dimethylethoxy)carbonyl]-L-phenylalanyl-N-[2,3-dihydroxy-5-methyl-1-(2-methylpropyl)-4-[[[2-methyl-1-[[(2-pyridinylmethyl)amino]carbonyl]butyl]amino]carbonyl]hexyl]-, [1S-[1R*,2S*,3R*,4S*(1R*,2R*)]]-

pdb file: 595424.pdb
sdf file: 595424.sdf
directory: 595424

127422-65-5 AIDS-001284 AIDS001284 CREHAYSRARTKNNY (Residues 360-373) L-Tyrosine, L-cysteinyl-L-arginyl-L-.alpha.-glutamyl-L-histidyl-L-alanyl-L-tyrosyl-L-seryl-L-arginyl-L-alanyl-L-arginyl-L-threonyl-L-lysyl-L-asparaginyl-L-asparaginyl- Peptide corresponding to aa residues 360-373 of Herpes Simplex Virus Vmw65 RG39 peptide 360-373

pdb file: 595828.pdb
sdf file: 595828.sdf
directory: 595828

129437-47-4 AIDS-001483 AIDS001483 HLA-DR.B. Peptide(141-155) L-Glutamine, L-valyl-L-valyl-L-seryl-L-threonylglycyl-L-leucyl-L-isoleucyl-L-glutaminyl-L-asparaginylglycyl-L-.alpha.-aspartyl-L-tryptophyl-L-threonyl-L-phenylalanyl-

pdb file: 596003.pdb
sdf file: 596003.sdf
directory: 596003

119400-71-4 AIDS-001893 AIDS001893 Glycine, L-histidyl-L-alanylglycyl-L-prolyl-L-isoleucyl-L-alanyl-L-prolylglycyl-L-glutaminyl-L-methionyl-L-arginyl-L-.alpha.-glutamyl-L-prolyl-L-arginyl- HAGPIAPGQMREPRG His-Ala-Gly-Pro-Ileu-Ala-Pro-Gly-Glu-Met-Arg-Glu-Pro-Arg-Gly gag prot. H15G(sequence 219-233)

pdb file: 596395.pdb
sdf file: 596395.sdf
directory: 596395

119420-07-4 AIDS-001894 AIDS001894 GAG5(sequence 193-203) GHQAAMEMLKE Gly-His-Glu-NH2-Ala-Ala-Met-Glu-Met-Leu-Lys-Glu L-Glutamic acid, N-[N2-[N-[N-[N-[N-[N-[N-[N2-(N-glycyl-L-histidyl)-L-glutaminyl]-L-alanyl]-L-alanyl]-L-methionyl]-L-.alpha.-glutamyl]-L-methionyl]-L-leucyl]-L-lysyl]-

pdb file: 596396.pdb
sdf file: 596396.sdf
directory: 596396

119400-70-3 AIDS-001895 AIDS001895 GAG3(sequence 446-460) GNFLQSRPEPTAPPA Gly-Asn-Phe-Leu-GluNH2-Ser-Arg-Pro-Glu-Pro-Threo-Ala-Pro-Pro-Ala L-Alanine, glycyl-L-asparaginyl-L-phenylalanyl-L-leucyl-L-glutaminyl-L-seryl-L-arginyl-L-prolyl-L-.alpha.-glutamyl-L-prolyl-L-threonyl-L-alanyl-L-prolyl-L-prolyl-

pdb file: 596397.pdb
sdf file: 596397.sdf
directory: 596397

119400-72-5 AIDS-001896 AIDS001896 KEGHQMKDCTERQANF L-Phenylalanine, L-lysyl-L-.alpha.-glutamylglycyl-L-histidyl-L-glutaminyl-L-methionyl-L-lysyl-L-.alpha.-aspartyl-L-cysteinyl-L-threonyl-L-.alpha.-glutamyl-L-arginyl-L-glutaminyl-L-alanyl-L-asparaginyl- Lys-Glu-Gly-His-GluNH2-Met-Lys-Asp-Cys-Threo-Glu-Arg-Glu-NH2-Ala-Asn-Phe gag prot. K16F(sequence 418-433)

pdb file: 596398.pdb
sdf file: 596398.sdf
directory: 596398

252035-68-0 AIDS-002039 AIDS002039 Ac-YTSLIHSLIEESQNQQEKNEQELLELDKWASLANAA-NH2 L-Alaninamide, N-acetyl-L-tyrosyl-L-threonyl-L-seryl-L-leucyl-L-isoleucyl-L-histidyl-L-seryl-L-leucyl-L-isoleucyl-L-a-glutamyl-L-a-glutamyl-L-seryl-L-glutaminyl-L-asparaginyl-L-glutaminyl-L-glutaminyl-L-a-glutamyl-L-lysyl-L-asparaginyl-L-a-glutamyl-L-glutaminyl-L-a-glutamyl-L-leucyl-L-leucyl-L-a-glutamyl-L-leucyl-L-a-aspartyl-L-lysyl-L-tryptophyl-L-alanyl-L-seryl-L-leucyl-L-alanyl-L-asparaginyl-L-alanyl- T229

pdb file: 596539.pdb
sdf file: 596539.sdf
directory: 596539

98818-73-6 AIDS-002074 AIDS002074 L-Phenylalaninamide, N-[5(S)-[[N-[N-[(1,1-dimethylethoxy)carbonyl]-L-phenylalanyl]-L-phenylalanyl]amino]-4(S)-hydroxy-1-oxo-6-phenyl-2(R or S)-(phenylmethyl)hexyl]-L-leucyl- N'-(1,1-Dimethylethoxycarbonyl)-Phe-Phe-5(S)-amino-4(S)-hydroxy-6-phenyl-2-(S or R)-(phenylmethyl)hexanoyl-Leu-

pdb file: 596571.pdb
sdf file: 596571.sdf
directory: 596571

133683-31-5 AIDS-002080 AIDS002080 Ac-Ala-Ala-Sta-Ile-NH2 L-Alaninamide, N-acetyl-L-alanyl-N-[4-[[1-(aminocarbonyl)-2-methylbutyl]amino]-2-hydroxy-1-(2-methylpropyl)-4-oxobutyl]-, [1S-[1R*,2R*,4(1R*,2R*)]]-

pdb file: 596577.pdb
sdf file: 596577.sdf
directory: 596577

133683-34-8 AIDS-002084 AIDS002084 Ac-Ala-Ala-D-Tyr-Pro-Ile-NH2 L-Isoleucinamide, N-acetyl-L-alanyl-L-alanyl-D-tyrosyl-L-prolyl-

pdb file: 596581.pdb
sdf file: 596581.sdf
directory: 596581

.beta.-Casomorphin-4-NH2 74135-04-9 AIDS-002088 AIDS002088 H-Tyr-Pro-Phe-Pro-NH2 L-Prolinamide, L-tyrosyl-L-prolyl-L-phenylalanyl- Morphiceptin Tyr-Pro-Phe-Pro-NH2 b-Casomorphin-4-amide

pdb file: 596585.pdb
sdf file: 596585.sdf
directory: 596585

34783-35-2 AIDS-002089 AIDS002089 L-Prolinamide, 5-oxo-L-prolyl-L-phenylalanyl- Pyroglutamyl-Phe-Pro-NH2

pdb file: 596586.pdb
sdf file: 596586.sdf
directory: 596586

98805-74-4 AIDS-002108 AIDS002108 Asp-Trp-Leu-Lys-Ala-Phe-Tyr-Asp-Lys-Val-Ala-Glu-Lys-Leu-Lys-Glu-Ala-Phe DWLKAFYDKVAEKLKEAF L-Phenylalanine, L-.alfa.-aspartyl-L-tryptophyl-L-leucyl-L-lysyl-L-alanyl-L-phenylalanyl-L-tyrosyl-L-.alfa.-aspartyl-L-lysyl-L-valyl-L-alanyl-L-.alfa.-glutamyl-L-lysyl-L-leucyl-L-lysyl-L-.alfa.-glutamyl-L-alanyl-

pdb file: 596597.pdb
sdf file: 596597.sdf
directory: 596597

98791-32-3 AIDS-002109 AIDS002109 KWLDAFYKDVAKELEKAF L-Phenylalanine, L-lysyl-L-tryptophyl-L-leucyl-L-.alfa.-aspartyl-L-alanyl-L-phenylalanyl-L-tyrosyl-L-lysyl-L-.alfa.-aspartyl-L-valyl-L-alanyl-L-lysyl-L-.alfa.-glutamyl-L-leucyl-L-.alfa.-glutamyl-L-lysyl-L-alanyl- Lys-Trp-Leu-Asp-Ala-Phe-Tyr-Lys-Asp-Val-Ala-Lys-Glu-Leu-Glu-Lys-Ala-Phe

pdb file: 596598.pdb
sdf file: 596598.sdf
directory: 596598

131222-71-4 AIDS-002110 AIDS002110 KAFEEVLAKKFYDKALWD L-Aspartic acid, L-lysyl-L-alanyl-L-phenylalanyl-L-.alfa.-glutamyl-L-.alfa.-glutamyl-L-valyl-L-leucyl-L-alanyl-L-lysyl-L-lysyl-L-phenylalanyl-L-tyrosyl-L-.alfa.-aspartyl-L-lysyl-L-alanyl-L-leucyl-L-tryptophyl- Lys-Ala-Phe-Glu-Glu-Val-Leu-Ala-Lys-Lys-Phe-Tyr-Asp-Lys-Ala-Leu-Trp-Asp

pdb file: 596599.pdb
sdf file: 596599.sdf
directory: 596599

(Asp-Trp-Leu-Lys-Ala-Phe-Tyr-Asp-Lys-Val-Ala-Glu-Lys-Leu-Lys-Glu-Ala-Phe)2 Ala 127609-13-6 AIDS-002111 AIDS002111 DWLKAFYDKVAEKLKEAF)2A DWLKAFYDKVAEKLKEAFADWLKAFYDKVAEKLKEAF L-Phenylalanine, L-.alpha.-aspartyl-L-tryptophyl-L-leucyl-L-lysyl-L-alanyl-L-phenylalanyl-L-tyrosyl-L-.alpha.-aspartyl-L-lysyl-L-valyl-L-alanyl-L-.alpha.-glutamyl-L-lysyl-L-leucyl-L-lysyl-L-.alpha.-glutamyl-L-alanyl-L-phenylalanyl-L-alanyl-L-.alpha.-aspartyl-L-tryptophyl-L-leucyl-L-lysyl-L-alanyl-L-phenylalanyl-L-tyrosyl-L-.alpha.-aspartyl-L-lysyl-L-valyl-L-alanyl-L-.alpha.-aspartyl-L-lysyl-L-leucyl-L-lysyl-L-.alpha.-glutamyl-L-alanyl-

pdb file: 596600.pdb
sdf file: 596600.sdf
directory: 596600

(Asp-Trp-Leu-Lys-Ala-Phe-Tyr-Asp-Lys-Val-Ala-Glu-Lys-Leu-Lys-Glu-Ala-Phe)2 Pro 98823-93-9 AIDS-002112 AIDS002112 DWLKAFYDKVAEKLKEAF)2P DWLKAFYDKVAEKLKEAFPDWLKAFYDKVAEKLKEAF L-Phenylalanine, L-.alpha.-aspartyl-L-tryptophyl-L-leucyl-L-lysyl-L-alanyl-L-phenylalanyl-L-tyrosyl-L-.alpha.-aspartyl-L-lysyl-L-valyl-L-alanyl-L-.alpha.-glutamyl-L-lysyl-L-leucyl-L-lysyl-L-.alpha.-glutamyl-L-alanyl-L-phenylalanyl-L-prolyl-L-.alpha.-aspartyl-L-tryptophyl-L-leucyl-L-lysyl-L-alanyl-L-phenylalanyl-L-tyrosyl-L-.alpha.-aspartyl-L-lysyl-L-valyl-L-alanyl-L-.alpha.-glutamyl-L-lysyl-L-leucyl-L-lysyl-L-.alpha.-glutamyl-L-alanyl-

pdb file: 596601.pdb
sdf file: 596601.sdf
directory: 596601

99273-04-8 AIDS-002113 AIDS002113 L-Leucine, L-leucyl-L-glutaminyl-L-asparaginyl-L-arginyl-L-arginylglycyl-L-leucyl-L-.alpha.-aspartyl-L-leucyl-L-leucyl-L-phenylalanyl-L-leucyl-L-lysyl-L-.alpha.-glutamylglycylglycyl- LQNRRGLDLLFLKEGGL-BSA Leu-Gln-Asn-Arg-Arg-Gly-Leu-Asp-Leu-Leu-Phe-Leu-Lys-Glu-Gly-Gly-Leu linked to BSA

pdb file: 596602.pdb
sdf file: 596602.sdf
directory: 596602

129426-47-7 AIDS-002160 AIDS002160 AVGIGA L-Alanine, L-alanyl-L-valylglycyl-L-isoleucylglycyl- N-terminal of gp41 of HIV-1-BH10 NH2-Ala-Val-Gly-Ile-Gly-Ala-COOH

pdb file: 596648.pdb
sdf file: 596648.sdf
directory: 596648

129399-72-0 AIDS-002161 AIDS002161 AVGAIG Glycine, N-[N-[N-[N-(N-L-alanyl-L-valyl)glycyl]-L-alanyl]-L-isoleucyl]- NH2-Ala-Val-Gly-Ala-Ile-Gly-COOH

pdb file: 596649.pdb
sdf file: 596649.sdf
directory: 596649

69288-25-1 AIDS-002162 AIDS002162 Ala-Val-Gly Glycine, L-alanyl-L-valyl- NH2-Ala-Val-Gly-COOH

pdb file: 596650.pdb
sdf file: 596650.sdf
directory: 596650

6-Phenyl-5-(N-butyloxycarbonylphenylalaninylphenylalaninylamino)-4-hydroxy-2-benzyl-1-(leucinylphenylalaninylamino)-hexanone 98818-74-7 AIDS-002828 AIDS002828 Boc-Phe-Phe-CH2Ph-Leu-Phe-NH2 L-364,505 L-Phenylalaninamide, N-[5(S)-[[N-[N-[(1,1-dimethylethoxy)carbonyl]-L-phenylalanyl]-L-phenylalanyl]amino]-4-(S)-hydroxy-1-oxo-6-phenyl-2(R)-(phenylmethyl)hexyl]-L-leucyl-

pdb file: 597295.pdb
sdf file: 597295.sdf
directory: 597295

1-5-.beta.-Neoendorphin (human), 6-ester with D-glucose 133733-37-6 6-(Tyrosylglycylglycylphenylalanylleucyl)-D-glucopyranose AIDS-003307 AIDS003307 L-Leucine, N-[N-[N-(N-L-tyrosylglycyl)glycyl]-L-phenylalanyl]-, 6-ester with D-glucose [5-Leu]enkephalin-related

pdb file: 597747.pdb
sdf file: 597747.sdf
directory: 597747

1-5-b-Neoendorphin (human), 6-ester with phenylmethyl b-D-glucopyranoside 117833-71-3 AIDS-003308 AIDS003308 L-Leucine, N-[N-[N-(N-L-tyrosylglycyl)glycyl]-L-phenylalanyl]-, 6-ester with phenylmethyl b-D-glucopyranoside [5-Leu]enkephalin-related

pdb file: 597748.pdb
sdf file: 597748.sdf
directory: 597748

1-5-.beta.-Neoendorphin (human), 6-ester with .beta.-D-glucopyranose 1,2,3,4-tetraacetate 117833-68-8 6-(Tyrosylglycylglycylphenylalanylleucyl)-.beta.-D-glucopyranosetetraacetate AIDS-003309 AIDS003309 [5-Leu]enkephalin-related

pdb file: 597749.pdb
sdf file: 597749.sdf
directory: 597749

1-5-b-Neoendorphin (human), .beta.-D-glucopyranosyl ester 117833-65-5 AIDS-003310 AIDS003310 L-Leucine, N-[N-[N-(N-L-tyrosylglycyl)glycyl]-L-phenylalanyl]-, .beta.-D-glucopyranosyl ester Tyrosylglycylglycylphenylalanylleucyl)-.beta.-D-glucopyranoside [5-Leu]enkephalin-related

pdb file: 597750.pdb
sdf file: 597750.sdf
directory: 597750

1-5-b-Neoendorphin (human), 1-(O-b-D-glucopyranosyl-L-tyrosine)- 113282-58-9 AIDS-003311 AIDS003311 L-Leucine, N-[N-[N-[N-(O-b-D-glucopyranosyl-L-tyrosyl)glycyl]glycyl]-L-phenylalanyl]- O-.beta.-D-Glucopyranosyltyrosylglycylglycylphenylalanylleucine [5-Leu]enkephalin-related

pdb file: 597751.pdb
sdf file: 597751.sdf
directory: 597751

136860-01-0 (.ALPHA.) 136892-40-5 (.BETA.) 6-Deoxy-6-(tyrosylglycylglycylphenylalanylleucylamino)-D-glucopyranose AIDS-003312 AIDS003312 D-Glucopyranose, 6-deoxy-6-[[N-[N-[N-(N-L-tyrosylglycyl)glycyl]-L-phenylalanyl]-L-leucyl]amino]- [5-Leu]enkephalin-related

pdb file: 597752.pdb
sdf file: 597752.sdf
directory: 597752

136860-02-1 (.ALPHA.) 136892-41-6 (.BETA.) 2-Deoxy-2-(tyrosylglycylglycylphenylalanylleucylamino)-D-glucopyranose AIDS-003313 AIDS003313 D-Glucopyranose, 2-deoxy-2-[[N-[N-[N-(N-L-tyrosylglycyl)glycyl]-L-phenylalanyl]-L-leucyl]amino]- [5-Leu]enkephalin-related

pdb file: 597753.pdb
sdf file: 597753.sdf
directory: 597753

1-5-.beta.-Neoendorphin (human), 5-(N-.beta.-D-glucopyranosyl-L-leucinamide)- 136802-61-4 AIDS-003314 AIDS003314 L-Leucinamide, L-tyrosylglycylglycyl-L-phenylalanyl-N-.beta.-D-glucopyranosyl- N-(Tyrosylglycylglycylphenylalanylleucyl)-.beta.-D-glucopyranosylamine [5-Leu]enkephalin-related

pdb file: 597754.pdb
sdf file: 597754.sdf
directory: 597754

138228-18-9 AIDS-003433 AIDS003433 KNI 122 KNI-122 L-Valinamide, L-seryl-L-phenylalanyl-L-asparaginyl-(2R,3S)-2-hydroxy-4-phenyl-3-aminobutanoyl-L-prolyl-L-isoleucyl- Phenylnorstatin deriv. Ser-Phe-Asn-Pns-Pro-Ile-Val-NH2

pdb file: 597866.pdb
sdf file: 597866.sdf
directory: 597866

(2S,3S)-Seryl-phenylalanyl-asparagyl-allophenylnorstatyl-prolyl-isoleucyl-valinamide AIDS-003434 AIDS003434 Allophenylnorstatin deriv. KNI-93 Ser-Phe-Asn-Apns-Pro-Ile-Val-NH2

pdb file: 597867.pdb
sdf file: 597867.sdf
directory: 597867

AIDS-003438 AIDS003438 Phenylnorstatin deriv. Val-Val-Pns-Phe-Val-Val-NH2 Valyl-valyl-phenylnorstatyl-phenylalanyl-valyl-valinamide

pdb file: 597871.pdb
sdf file: 597871.sdf
directory: 597871

AIDS-003439 AIDS003439 Acetylphenylalanyl deriv. N-[2-(N-Acetyl-phenylalanyl-asparaginyl)-3-(phenyl)propyl]prolyl-glutamyl-isoleucine amide

pdb file: 597872.pdb
sdf file: 597872.sdf
directory: 597872

AIDS-003458 AIDS003458 Boc-Phe[CH(OH)CH2]Phe-Ile-Phe-NH2 N'-(Phenylalanyl)-N-[5(S)-[(tert-butoxycarbonyl)amino]-4(S)-hydroxy-6-phenyl-2(R)-(phenylmethyl)hexanoyl]isoleucine amide

pdb file: 597891.pdb
sdf file: 597891.sdf
directory: 597891

4'-(Alan-N2-yl)avarone 4'-Alanylavarone AIDS-003603 AIDS003603

pdb file: 598035.pdb
sdf file: 598035.sdf
directory: 598035

4'-(Phenylalan-N2-yl)avarone 4'-(Phenylalanyl)avarone AIDS-003604 AIDS003604

pdb file: 598036.pdb
sdf file: 598036.sdf
directory: 598036

3-(2-Hydroxyethylidene)-2-(benzylleucylphenylalanylcarbonyl)-7-oxo-4-oxa-1-azabicyclo[3.2.0]heptane AIDS-003849 AIDS003849 Clavulanic acid deriv.

pdb file: 598274.pdb
sdf file: 598274.sdf
directory: 598274

6-Amino-7-oxo-3,3-dimethyl-2-(methylphenylalanylcarbonyl)-4-thia-1-azabicyclo[3.2.0]heptane 6-Aminopenicillanic acid 6APA AIDS-003850 AIDS003850 Penicillanic acid deriv.

pdb file: 598275.pdb
sdf file: 598275.sdf
directory: 598275

AIDS-004251 AIDS004251 CbzAF(CHOHCH2)GVVOMe [3-(N-Benzyloxycarbonylalanyl)-2-hydroxy-4-phenylbutyl]glycylvalylvaline methyl ester

pdb file: 598669.pdb
sdf file: 598669.sdf
directory: 598669

AIDS-004253 AIDS004253 CbzAAF(CHOHCH2)GVVOMe [3-(N-Benzyloxycarbonylalanylalanyl)-2-hydroxy-4-phenylbutyl]glycylvalylvaline methyl ester

pdb file: 598671.pdb
sdf file: 598671.sdf
directory: 598671

AIDS-004254 AIDS004254 CbzAF(CHOHCH2)AVVOMe [3-(N-Benzyloxycarbonylalanyl)-2-hydroxy-4-phenylbutyl]alanylvalylvaline methyl ester

pdb file: 598672.pdb
sdf file: 598672.sdf
directory: 598672

AIDS-004255 AIDS004255 CbzAAF(CHOHCH2)AVVOMe [3-(N-Benzyloxycarbonylalanylalanyl)-2-hydroxy-4-phenylbutyl]alanylvalylvaline methyl ester

pdb file: 598673.pdb
sdf file: 598673.sdf
directory: 598673

(2S,3R,4S)-N-[N-(N-Benzyloxycarbonyl)-L-phenylalanyl]-L-alanyl-1-phenyl-2-amino-3,4-epoxy-6-methylheptane AIDS-004408 AIDS004408 Cbz-Phe-Ala-1Ph2NH3,4Epox6MeHep

pdb file: 600075.pdb
sdf file: 600075.sdf
directory: 600075

17466-45-4 AIDS-004472 AIDS004472 Cyclo(L-alanyl-2-mercapto-L-tryptophanyl-4,5-dihydroxy-L-leucyl-L-alanyl-threonyl-cysteinyl-L-cis-4-hydroxy-L-prolyl, cyclic (2, 6)-sulfide Phalloidin

pdb file: 600138.pdb
sdf file: 600138.sdf
directory: 600138

26645-35-2 AIDS-004494 AIDS004494 Cyclo(L-alanyl-2-mercapto-L-tryptophanyl-4,5-dihydroxy-L-leucyl-L-valyl-erythro-3-hydroxy-D-.alpha.-aspartyl-L-cysteinyl-cis-4-hydroxy-L-prolyl, cyclic (2, 6)-sulfide Phallacidin

pdb file: 600160.pdb
sdf file: 600160.sdf
directory: 600160

AIDS-006053 AIDS006053 Ac-Ala-Arg-Val-Leu.psi.[]Ala-Glu-Ala-NH2 N-Acetyl-L-alanyl-L-arginyl-L-valyl-(2R,3S)-2,5-dimethyl-3-aminohexanoyl-L,.alpha.-glutamyl-L-alaninamide

pdb file: 601698.pdb
sdf file: 601698.sdf
directory: 601698

AIDS-006054 AIDS006054 Ac-Ala-Arg-Val-Leu.psi.[]Ala-Glu-Ala-NH2 N-Acetyl-L-alanyl-L-arginyl-L-valyl-(2R,3R)-2,5-dimethyl-3-aminohexanoyl-L,.alpha.-glutamyl-L-alaninamide

pdb file: 601699.pdb
sdf file: 601699.sdf
directory: 601699

AIDS-006055 AIDS006055 Ac-Ala-Arg-Val-Leu.psi.[]Ala-Glu-Ala-NH2 N-Acetyl-L-alanyl-L-arginyl-L-valyl-(2S,3S)-2,5-dimethyl-3-aminohexanoyl-L,.alpha.-glutamyl-L-alaninamide

pdb file: 601700.pdb
sdf file: 601700.sdf
directory: 601700

AIDS-006056 AIDS006056 Ac-Ala-Arg-Val-Leu.psi.[]Ala-Glu-Ala-NH2 N-Acetyl-L-alanyl-L-arginyl-L-valyl-(2S,3R)-2,5-dimethyl-3-aminohexanoyl-L,.alpha.-glutamyl-L-alaninamide

pdb file: 601701.pdb
sdf file: 601701.sdf
directory: 601701

185567-06-0 4-Thiazolidinecarboxamide, N-(4-morpholinylacetyl)-3-(1-naphthalenyl)-L-alanyl-N-methyl-L-valyl-(.alpha.S,.beta.S)-.beta.-amino-.alpha.-hydroxybenzenebutanoyl-N-(1,1-dimethylethyl)-, (4R)- AIDS-006261 AIDS006261

pdb file: 601904.pdb
sdf file: 601904.sdf
directory: 601904

185567-10-6 4-Thiazolidinecarboxamide, N-[3-(4-morpholinyl)-1-oxopropyl]-3-(1-naphthalenyl)-L-alanyl-N-methyl-L-valyl-(.alpha.S,.beta.S)-.beta.-amino-.alpha.-hydroxybenzenebutanoyl-N-(1,1-dimethylethyl)-, (4R)- AIDS-006454 AIDS006454

pdb file: 602091.pdb
sdf file: 602091.sdf
directory: 602091

AIDS-006479 AIDS006479 Cbz-Phe-Phe-H N-[N-[(Phenylmethoxy)carbonyl]-L-phenylalanyl]-L-phenylalanine, aldehyde deriv.

pdb file: 602116.pdb
sdf file: 602116.sdf
directory: 602116

AIDS-006480 AIDS006480 Cbz-Ala-Phe-H N-[N-[(Phenylmethoxy)carbonyl]-L-alanyl]-L-phenylalanine, aldehyde deriv.

pdb file: 602117.pdb
sdf file: 602117.sdf
directory: 602117

AIDS-006694 AIDS006694 Carbonyl-bis(L-phenylalanyl-L-valine methyl ester) L-Phe-L-Val-OMe urea deriv.

pdb file: 602331.pdb
sdf file: 602331.sdf
directory: 602331

AIDS-006729 AIDS006729 L-Phe-L-Val-OMe malonyl deriv. Malonyl-bis(L-phenylalanyl-L-valine methyl ester)

pdb file: 602366.pdb
sdf file: 602366.sdf
directory: 602366

86632-63-5 AIDS-008562 AIDS008562 Dipeptidyl Polyoxin L analog Homophenylalanyl Uracil Polyoxin C

pdb file: 603335.pdb
sdf file: 603335.sdf
directory: 603335

1-[5'-(L-Alanylamino)-5'- deoxy-.beta.-D- allofuranosyluronic acid]uracil 93806-72-5 AIDS-008571 AIDS008571 L-alanyl UPOC analog

pdb file: 603344.pdb
sdf file: 603344.sdf
directory: 603344

.alpha.-L-Talofuranuronic acid, 5-[(2-amino-1-oxopropyl)amino]-1,5-dideoxy-1-(3,4-dihydro-2,4-dioxo-1(2H)-pyrimidinyl)-, (S)- 1-[5'-(L-Alanylamino)-5'-deoxy-.alpha.-L-talofuranosyluronic acid]uracil 93806-79-2 AIDS-008575 AIDS008575 L-alanyl UPOC analog

pdb file: 603347.pdb
sdf file: 603347.sdf
directory: 603347

1-[5'-(L-Alanylmethylamino)-5'-deoxy-.beta.-D- allofuranosyluronic acid]uracil 93806-87-2 AIDS-008578 AIDS008578 L-alanylpolyoxin C analog

pdb file: 603350.pdb
sdf file: 603350.sdf
directory: 603350

107600-09-9 AIDS-008879 AIDS008879 L-Histidinamide, N-[(1,1-dimethylethoxy)carbonyl]-L-phenylalanyl-N-[2,3-dihydroxy-5-methyl-1-(2-methylpropyl)-4-[[[2-methyl-1-[[(2-pyridinylmethyl)amino]carbonyl]butyl]amino]carbonyl]hexyl]-, [1S-[1R*,2S*,3S*,4S*(1R*,2R*)]]-

pdb file: 603534.pdb
sdf file: 603534.sdf
directory: 603534

1,2-Benzo-8-(DL-alanyl)-3-phenoxazone 3-(5-Oxo-5H-benzo[a]phenoxazin-10-yl)alanine AIDS-014334 AIDS014334 Bhansali NSC643735 (NITRATE SALT)

pdb file: 605971.pdb
sdf file: 605971.sdf
directory: 605971

AIDS-015259 AIDS015259 NSC351095 Tert-butyl 1-[(benzyloxy)carbonyl]prolylphenylalanylleucinate

pdb file: 606193.pdb
sdf file: 606193.sdf
directory: 606193

110655-58-8 1405-39-6 (DELETED) AIDS-017425 AIDS017425 Cinnamycin L-Lysine, L-cysteinyl-L-arginyl-L-glutaminyl-D-cysteinyl-L-cysteinyl-3-aminoalanyl-L-phenylalanylglycyl-L-prolyl-L-phenylalanyl-(2S,3S)-2-amino-3-mercaptobutanoyl-L-phenylalanyl-L-valyl-L-cysteinyl-(3R)-3-hydroxy-L-.alpha.-aspartylglycyl-L-asparaginyl-(2S,3S)-2-amino-3-mercaptobutanoyl-, cyclic (1 =

pdb file: 606876.pdb
sdf file: 606876.sdf
directory: 606876

185567-09-3 4-Thiazolidinecarboxamide, N,N-dimethylglycyl-3-(1-naphthalenyl)-L-alanyl-N-methyl-L-valyl-(.alpha.S,.beta.S)-.beta.-amino-.alpha.-hydroxybenzenebutanoyl-N-(1,1-dimethylethyl)-, (4R)- AIDS-020214 AIDS020214

pdb file: 609631.pdb
sdf file: 609631.sdf
directory: 609631

(2R,3S,4S)-N-[2-(Benzylamino)-4-[[N-[(benzyloxy)carbonyl]-L-alanyl]amino]-3-hydroxy-5- phenylpentanoyl]-L-valine benzylamide 161594-18-9 AIDS-025166 AIDS025166 Ala-Val-Sta, 5PhBuCOOH deriv. Statine deriv.

pdb file: 610830.pdb
sdf file: 610830.sdf
directory: 610830

3'-Azido-3'-deoxythymidine, 5'-(O-benzyl-L-phenylalanyl-propyldicarbonyl) deriv. AIDS-025279 AIDS025279 AZT-COCO-Pro-L-Phe-OBzl CPF(L)-AZT

pdb file: 610943.pdb
sdf file: 610943.sdf
directory: 610943

2',3'-Dideoxyuridine, 5'-(O-benzyl-D-phenylalanyl-prolyldicarbonyl) deriv. AIDS-025280 AIDS025280 CPF(D)-ddU ddU-COCO-Pro-D-Phe-OBzl

pdb file: 610944.pdb
sdf file: 610944.sdf
directory: 610944

2',3'-Dideoxycytidine, 5'-(O-benzyl-D-phenylalanyl-prolyldicarbonyl) deriv. AIDS-025281 AIDS025281 CPF(D)-ddC ddC-COCO-Pro-D-Phe-OBzl

pdb file: 610945.pdb
sdf file: 610945.sdf
directory: 610945

2',3'-Dideoxyinosine, 5'-(O-benzyl-D-phenylalanyl-prolyldicarbonyl) deriv. AIDS-025282 AIDS025282 CPF(D)-ddI ddI-COCO-Pro-D-Phe-OBzl

pdb file: 610946.pdb
sdf file: 610946.sdf
directory: 610946

2',3'-Dideoxyadenosine, 5'-(O-benzyl-D-phenylalanyl-prolyldicarbonyl) deriv. AIDS-025283 AIDS025283 CPF(D)-ddA ddA-COCO-Pro-D-Phe-OBzl

pdb file: 610947.pdb
sdf file: 610947.sdf
directory: 610947

AIDS-025286 AIDS025286 H-Ser-Phe-Leu-Thr-OH N-[N-(N-L-Seryl-L-phenylalanyl)L-leucyl]-L-threonine

pdb file: 610950.pdb
sdf file: 610950.sdf
directory: 610950

AIDS-027958 AIDS027958 N-[((5S,6S)-5-{[4,6-Dideoxy-4-(methylamino)-3-O-pentopyranosylhexopyranosyl]oxy}-1,6,9,14-tetrahydroxy-11-methoxy-3-methyl-8,13-dioxo-5,6,8,13-tetrahydrobenzo[a]tetracen-2-yl)carbonyl]-D-alanyl-D-alanine PRADIMICIN DER.

pdb file: 611639.pdb
sdf file: 611639.sdf
directory: 611639

AIDS-027959 AIDS027959 N-[((5S,6S)-5-{[4,6-Dideoxy-4-(methylamino)-3-O-pentopyranosylhexopyranosyl]oxy}-1,6,9,14-tetrahydroxy-11-methoxy-3-methyl-8,13-dioxo-5,6,8,13-tetrahydrobenzo[a]tetracen-2-yl)carbonyl]-D-alanyl-L-alanine PRADIMICIN DER.

pdb file: 611640.pdb
sdf file: 611640.sdf
directory: 611640

AIDS-027960 AIDS027960 N-[((5S,6S)-5-{[4,6-Dideoxy-4-(methylamino)-3-O-pentopyranosylhexopyranosyl]oxy}-1,6,9,14-tetrahydroxy-11-methoxy-3-methyl-8,13-dioxo-5,6,8,13-tetrahydrobenzo[a]tetracen-2-yl)carbonyl]-D-alanyl-L-aspartic acid PRADIMICIN DER.

pdb file: 611641.pdb
sdf file: 611641.sdf
directory: 611641

AIDS-027961 AIDS027961 N-[((5S,6S)-5-{[4,6-Dideoxy-4-(methylamino)-3-O-pentopyranosylhexopyranosyl]oxy}-1,6,9,14-tetrahydroxy-11-methoxy-3-methyl-8,13-dioxo-5,6,8,13-tetrahydrobenzo[a]tetracen-2-yl)carbonyl]-D-alanylglycine PRADIMICIN DER.

pdb file: 611642.pdb
sdf file: 611642.sdf
directory: 611642

AIDS-027976 AIDS027976 N-[((5S,6S)-5-{[4,6-Dideoxy-4-(methylamino)-3-O-pentopyranosylhexopyranosyl]oxy}-1,6,9,14-tetrahydroxy-11-methoxy-3-methyl-8,13-dioxo-5,6,8,13-tetrahydrobenzo[a]tetracen-2-yl)carbonyl]-D-alanyl-L-lysine PRADIMICIN DER.

pdb file: 611657.pdb
sdf file: 611657.sdf
directory: 611657

3'-Azido-3'-deoxythymidine, 5'-(O-benzyl-D-phenylalanyl-propyldicarbonyl) deriv. AIDS-028375 AIDS028375 AZT-COCO-Pro-D-Phe-OBzl CPF(D)-AZT

pdb file: 612055.pdb
sdf file: 612055.sdf
directory: 612055

159105-12-1 AIDS-029507 AIDS029507 CYCLOPEPTOLIDE DER. Cyclo[L-alanyl-(2S)-2-piperidinecarbonyl-N-methyl-L-valyl-L-valyl-N-methyl-L-.alpha.-aspartyl-N-methyl-L-isoleucyl-N-methyl-L-isoleucylglycyl-N-methyl-L-valyl-O-methyl-L-tyrosyl]

pdb file: 612549.pdb
sdf file: 612549.sdf
directory: 612549

159170-92-0 AIDS-029508 AIDS029508 CYCLOPEPTOLIDE Cyclo[D-alanyl-(2S)-2-piperidinecarbonyl-N-methyl-L-valyl-L-valyl-N-methyl-L-.alpha.-aspartyl-N-methyl-L-isoleucyl-N-methyl-L-isoleucylglycyl-N-methyl-L-valyl-O-methyl-L-tyrosyl]

pdb file: 612550.pdb
sdf file: 612550.sdf
directory: 612550

4-Thiazolidinecarboxamide, N-(4-morpholinylacetyl)-3-(1-naphthalenyl)-L-alanyl-L-valyl-(.alpha.S,.beta.S)-.beta.-amino-.alpha.-hydroxybenzenebutanoyl-N-(1,1-dimethylethyl)-, (4R)- AIDS-029857 AIDS029857

pdb file: 612885.pdb
sdf file: 612885.sdf
directory: 612885

4-Thiazolidinecarboxamide, N-[3-(4-morpholinyl)-1-oxopropyl]-3-(1-naphthalenyl)-L-alanyl-L-valyl-(.alpha.S,.beta.S)-.beta.-amino-.alpha.-hydroxybenzenebutanoyl-N-(1,1-dimethylethyl)-, (4R)- AIDS-029859 AIDS029859

pdb file: 612887.pdb
sdf file: 612887.sdf
directory: 612887

58822-25-6 AIDS-030267 AIDS030267 L-Leucine, N-(N-(N-(N-L-tyrosylglycyl)glycyl)-L-phenylalanyl)- Leucine enkephalin NSC350588 [Leu 5]enkephalin

pdb file: 613089.pdb
sdf file: 613089.sdf
directory: 613089

AIDS-030408 AIDS030408 Glycinamide, N-acetylvalylalanylprolylglycylvalyl-N1-methyl- NSC668013

pdb file: 613175.pdb
sdf file: 613175.sdf
directory: 613175

AIDS-030409 AIDS030409 Glycine, N-[(1,1-dimethylethoxy)carbonyl]valylalanylprolylglycylvalyl-, phenylmethyl ester NSC668014

pdb file: 613176.pdb
sdf file: 613176.sdf
directory: 613176

AIDS-030421 AIDS030421 Glycinamide, N-[(1,1-dimethylethoxy)carbonyl]-4-nitrophenylalanyl-N1-ethyl- NSC669648

pdb file: 613188.pdb
sdf file: 613188.sdf
directory: 613188

1,2-Benzo-8-(L-alanyl)-3-phenoxazone 5H-Benzo[a]phenoxazine-10-propanoic acid, alpha-amino-5-oxo-, (a10S)- AIDS-030440 AIDS030440 NSC672425

pdb file: 613207.pdb
sdf file: 613207.sdf
directory: 613207

AIDS-030442 AIDS030442 NSC672462 Threoninamide, N-[(phenylmethoxy)carbonyl]phenylalanyl-S-(acetylmethylamino)cysteinylphenylalanyltryptophyl-N~6~-[(phenylmethoxy)carbonyl]lysyl-O-(phenylmethyl)threonyl-S-(acetylmethylamino)cysteinyl-O-(phenylmethyl)-

pdb file: 613209.pdb
sdf file: 613209.sdf
directory: 613209

AIDS-030443 AIDS030443 NSC672663 Phenylalaninamide, N-[(phenylmethoxy)carbonyl]phenylalanyltryptophyl-N~6~-[(1,1-dimethylethoxy)carbonyl]lysyl-O-(1,1-dimethylethyl)threonyl-N-[1-(methoxycarbonyl)cyclopentyl]-

pdb file: 613210.pdb
sdf file: 613210.sdf
directory: 613210

1,2-Benzo-8-(D-alanyl)-3-phenoxazone 5H-Benzo[a]phenoxazine-10-propanoic acid, alpha-amino-5-oxo-, (a10R)- AIDS-030482 AIDS030482 NSC672426

pdb file: 613249.pdb
sdf file: 613249.sdf
directory: 613249

AIDS-030798 AIDS030798 Ac-Leu-Val-Phe[CHOHCH2]Phe-Ile-Val-NH2 N-{(2R,3S)-3-[(N-Acetyl-L-leucyl-L-valyl)amino]-2-hydroxy-4-phenylbutyl}-L-phenylalanyl-L-isoleucyl-L-valinamide

pdb file: 613532.pdb
sdf file: 613532.sdf
directory: 613532

159440-06-9 4-Piperidinecarboxylic acid, 1-[N-[N-[(2-methylpropoxy)carbonyl]-D-phenylalanyl]-3-(1-naphthalenyl)-D-alanyl]-, 1-[[[1-(aminocarbonyl)-2-methylpropyl]amino]carbonyl]-3-methylbutyl ester, [S-(R*,R*)]- AIDS-031421 AIDS031421 Peptide 7140 iBOC-[D-Phe]-[D-.alpha.-Nal]-Pip-[.alpha.-(OH)-Leu]-Val-NH2

pdb file: 613878.pdb
sdf file: 613878.sdf
directory: 613878

159440-07-0 4-Piperidinecarboxylic acid, 1-[N-[N-[9-hydroxy-9-oxido-1,4,15-trioxo-12-[(1-oxohexadecyl)oxy]-8,10,14-trioxa-5-aza-9-phosphatriacont-1-yl]-D-phenylalanyl]-3-(1-naphthalenyl)-D-alanyl]-, 1-[[[1-(aminocarbonyl)-2-methylpropyl]amino]carbonyl]-3-methylbutyl ester, stereoisomer AIDS-031533 AIDS031533 DPPE-Suc-[D-Phe]-[D-.alpha.-Nal]-Pip-[.alpha.-(OH)-Leu]-Val-NH2 Peptide 7172

pdb file: 613985.pdb
sdf file: 613985.sdf
directory: 613985

159440-08-1 4-Piperidinecarboxylic acid, 1-[N-[N-[(2-methylpropoxy)carbonyl]-L-phenylalanyl]-3-(2-naphthalenyl)-D-alanyl]-, 1-[[(1-carboxy-2-methylpropyl)amino]carbonyl]-3-methylbutyl ester, [S-(R*,R*)]- AIDS-031534 AIDS031534 Peptide 7194 iBOC-[L-Phe]-[D-.beta.-Nal]-Pip-[.alpha.-(OH)-Leu]-Val

pdb file: 613986.pdb
sdf file: 613986.sdf
directory: 613986

159440-09-2 4-Piperidinecarboxylic acid, 1-[N-[N-[(2-methylpropoxy)carbonyl]-L-phenylalanyl]-3-(2-naphthalenyl)-D-alanyl]-, 10-hydroxy-4-(1-methylethyl)-1-(2-methylpropyl)-10-oxido-2,5,16-trioxo-13-[(1-oxohexadecyl)oxy]-9,11,15-trioxa-3,6-diaza-10-phosphahentriacont-1-yl ester, [1S-(1R*,4R*,13S)]- AIDS-031535 AIDS031535 Peptide 7196 iBOC-[L-Phe]-[D-.beta.-Nal]-Pip-[.alpha.-(OH)-Leu-Val-DPPE

pdb file: 613987.pdb
sdf file: 613987.sdf
directory: 613987

AIDS-031591 AIDS031591 LY289612 analog N-(tert-butyl)-2-((2R,3S)-2-hydroxy-3-{[N-(methylsulfonyl)-3-(pyridin-2-ylsulfinyl)-D-alanyl]amino}-4-phenylbutyl)benzamide

pdb file: 614030.pdb
sdf file: 614030.sdf
directory: 614030

102396-24-7 AIDS-032066 AIDS032066 Cyclo[(3R)-3-(4-hydroxyphenyl)-.beta.-alanyl-(2S,4E,6R,8S)-8-hydroxy-2,4,6-trimethyl-4-nonenoyl-L-alanyl-2-bromo-N-methyl-D-tryptophyl] Jasplakinolide NSC613009

pdb file: 614196.pdb
sdf file: 614196.sdf
directory: 614196

12656-09-6 AIDS-032105 AIDS032105 Alaninamide, N-[[2-[21-(1,2-dihydroxy-1-methylpropyl)-14-ethylidene-3,9,10,11,12,13,14,18,19,20,21,27,28,32a,39,40-hexadecahydro-39-hydroxy-11,43-bis(1-hydroxyethyl)-34-methyl-49,52-bis(methylene)-46-(1-methylethyl)-9,12,19,26,36,47,50,53,56-nonaoxo-17H,26H-4a,28-(iminoethaniminoethaniminoethaniminoethanimino[7,2]quinolinomethanoxymethano)-8,5:18,15:25,22:32,29-tetranitrilo-4H,15H-pyrido[3,2-m][1,11,17,24,4,7,20,27]tetrathiatetraazacyclotriacontin-2-yl]-4-thiazolyl]carbonyl]-2,3-didehydroalanyl-2,3-didehydro- NSC285116 Siomycin A

pdb file: 614213.pdb
sdf file: 614213.sdf
directory: 614213

AIDS-032490 AIDS032490 Ala-Ala-Phe-EtCONH2 deriv. L-Alanyl-N1-((1S,2S,4R)-5-{[1H-benzimidazol-2-yl(phenyl)methyl]amino}-1-benzyl-2-hydroxy-4-methyl-5-oxopentyl)-L-alaninamide

pdb file: 614574.pdb
sdf file: 614574.sdf
directory: 614574

AIDS-032491 AIDS032491 Ala-Ala-Phe-EtCONH2 deriv. L-Alanyl-N1-[(1S,2S,4R)-1-benzyl-2-hydroxy-5-({1H-indol-2-yl[3-(trifluoromethyl)phenyl]methyl}amino)-4-methyl-5-oxopentyl]-L-alaninamide

pdb file: 614575.pdb
sdf file: 614575.sdf
directory: 614575

AIDS-032492 AIDS032492 Ala-Ala-Phe-EtCONH2 deriv. L-Alanyl-N1-((1S,2S,4R)-1-benzyl-2-hydroxy-5-{[1H-indol-2-yl(3-methylphenyl)methyl]amino}-4-methyl-5-oxopentyl)-L-alaninamide

pdb file: 614576.pdb
sdf file: 614576.sdf
directory: 614576

AIDS-032493 AIDS032493 Ala-Ala-Phe-EtCONH2 deriv. L-Alanyl-N1-((1S,2S,4R)-5-{[(3-aminophenyl)(1H-indol-2-yl)methyl]amino}-1-benzyl-2-hydroxy-4-methyl-5-oxopentyl)-L-alaninamide

pdb file: 614577.pdb
sdf file: 614577.sdf
directory: 614577

AIDS-032494 AIDS032494 Ala-Ala-Phe-EtCONH2 deriv. L-Alanyl-N1-((1S,2S,4R)-1-benzyl-2-hydroxy-5-{[1H-indol-2-yl(pyridin-4-yl)methyl]amino}-4-methyl-5-oxopentyl)-L-alaninamide

pdb file: 614578.pdb
sdf file: 614578.sdf
directory: 614578

AIDS-032495 AIDS032495 Ala-Ala-Phe-EtCONH2 deriv. L-Alanyl-N1-((1S,2S,4R)-1-benzyl-5-{[cyclohexyl(1H-indol-2-yl)methyl]amino}-2-hydroxy-4-methyl-5-oxopentyl)-L-alaninamide

pdb file: 614579.pdb
sdf file: 614579.sdf
directory: 614579

AIDS-032496 AIDS032496 Ala-Ala-Phe-EtCONH2 deriv. L-Alanyl-N1-((1S,2S,4R)-1,4-dibenzyl-2-hydroxy-5-{[1H-indol-2-yl(phenyl)methyl]amino}-5-oxopentyl)-L-alaninamide

pdb file: 614580.pdb
sdf file: 614580.sdf
directory: 614580

5-(Ala-Ala)6Ph-PenCONH deriv. 5-(L-Alanyl-L-alanylamino)-4-hydroxy-6-phenylhexanoic acid benzhydrylamide AIDS-032606 AIDS032606

pdb file: 614690.pdb
sdf file: 614690.sdf
directory: 614690

5-(Ala-Ala)6Ph-PenCONH deriv. 5-(L-Alanyl-L-alanylamino)-4-hydroxy-6-phenylhexanoic acid ((1H-indol-2-yl)phenylmethyl)amide AIDS-032607 AIDS032607

pdb file: 614691.pdb
sdf file: 614691.sdf
directory: 614691

5-(Ala-Ala)6Ph-PenCONH deriv. 5-(L-Alanyl-L-alanylamino)-4-hydroxy-6-phenylhexanoic acid ((1H-ibenzimidazol-2-yl)phenylmethyl)amide AIDS-032608 AIDS032608

pdb file: 614692.pdb
sdf file: 614692.sdf
directory: 614692

185567-07-1 4-Thiazolidinecarboxamide, N-(4-morpholinylacetyl)-3-(1-naphthalenyl)-L-alanyl-N-methyl-3-(2-thiazolyl)-L-alanyl-(.alpha.S,.beta.S)-.beta.-amino-.alpha.-hydroxybenzenebutanoyl-N-(1,1-dimethylethyl)-, (4R)- AIDS-032615 AIDS032615

pdb file: 614699.pdb
sdf file: 614699.sdf
directory: 614699

AIDS-043106 AIDS043106 Boc-2-Nal-Asn-[Phe-CHOHCH2)-Pro]-Ile-Val-OMe Methyl 1-((3S)-3-{[N-(tert-butoxycarbonyl)-3-(2-naphthyl)alanylasparaginyl]amino}-2-hydroxy-4-phenylbutyl)prolylisoleucylvalinate

pdb file: 616954.pdb
sdf file: 616954.sdf
directory: 616954

2-Quin-CO(MeSO2Ala)Phe Epoxy deriv. AIDS-045172 AIDS045172 [(5S)-[[N-(2-quinolinecarbonyl)-.beta.-methanesulfonyl-L-alanylyl]amino]-(4R,3S)-epoxy-6-phenyl-hexanoyl]-[(2S)-[1-phenyl-3-methyl]butyl]amide

pdb file: 618512.pdb
sdf file: 618512.sdf
directory: 618512

AIDS-045175 AIDS045175 Cbz-(MeSO2-Val)Phe Epoxy deriv. [[(5S)-[(N-Benzyloxycarbonyl)-.beta.-methanesulfonyl-L-alanylyl]amino]-(4R,3S)-epoxy-6-phenyl-hexanoyl]-[(2S)-[1-phenyl-3-methyl]butyl]amide

pdb file: 618515.pdb
sdf file: 618515.sdf
directory: 618515

AIDS-045701 AIDS045701 Ac-Leu-Val-Phe[CHOHCH2]Phe-Ile-Val-NH2 N-{(2S,3S)-3-[(N-Acetyl-L-leucyl-L-valyl)amino]-2-hydroxy-4-phenylbutyl}-L-phenylalanyl-L-isoleucyl-L-valinamide

pdb file: 619014.pdb
sdf file: 619014.sdf
directory: 619014

AIDS-050819 AIDS050819 L289612 analog N-(tert-butyl)-2-((2R,3S)-2-hydroxy-3-{[N-(methylsulfonyl)-3-(pyridin-2-ylsulfinyl)-D-alanyl]amino}-4-phenylbutyl)benzamide

pdb file: 620107.pdb
sdf file: 620107.sdf
directory: 620107

AIDS-051268 AIDS051268 Macrocylic deriv. N-{(2R)-2-Hydroxy-2-[(8S,11S)-8-isopropyl-6,9-dioxo-2-oxa-7,10-diazabicyclo[11.2.2]heptadeca-1(15),13,16-trien-11-yl]ethyl}-L-phenylalanyl-L-isoleucyl-L-valinamide

pdb file: 620443.pdb
sdf file: 620443.sdf
directory: 620443

AIDS-051428 AIDS051428 Epoxy deriv. N-[(Benzyloxy)carbonyl]-L-phenylalanyl-N1-{(1S)-1-[(2R,3S)-3-isobutyloxiran-2-yl]-2-phenylethyl}glycinamide

pdb file: 620597.pdb
sdf file: 620597.sdf
directory: 620597

AIDS-057024 AIDS057024 Cis-Epoxide deriv. N-[(Benzyloxy)carbonyl]-L-phenylalanyl-N1-{(1S)-1-[(2R,3S)-3-isobutyloxiran-2-yl]-2-phenylethyl}-L-alaninamide

pdb file: 621492.pdb
sdf file: 621492.sdf
directory: 621492

AIDS-057620 AIDS057620[4'-nitroacridone-9'(10H)] NSC697469

pdb file: 621807.pdb
sdf file: 621807.sdf
directory: 621807

AIDS-057710 AIDS057710 Boc-Phe[CHCH2NH]Phe-Ile-Phe-NH2 N-{(3S)-3-[(tert-Butoxycarbonyl)amino]-4-phenylbutyl}-L-phenylalanylisoleucyl-L-phenylalaninamide

pdb file: 621850.pdb
sdf file: 621850.sdf
directory: 621850

AIDS-057711 AIDS057711 Boc-Phe[CHCH2NH]Phe-Glu-Phe-NH2 N-{(3S)-3-[(tert-Butoxycarbonyl)amino]-4-phenylbutyl}-L-phenylalanyl-L-a-glutamyl-L-phenylalaninamide

pdb file: 621851.pdb
sdf file: 621851.sdf
directory: 621851

AIDS-057816 AIDS057816 Boc-Phe[CH(OH)CH2NH]Phe-Ile-Phe-NH2 N-{(2S,3S)-3-[(tert-Butoxycarbonyl)amino]-2-hydroxy-4-phenylbutyl}-L-phenylalanyl-L-isoleucyl-L-phenylalaninamide

pdb file: 621954.pdb
sdf file: 621954.sdf
directory: 621954

AIDS-057817 AIDS057817 Boc-Phe[CH(OH)CH2NH]Phe-Ile-Phe-NH2 N-{(2R,3S)-3-[(tert-Butoxycarbonyl)amino]-2-hydroxy-4-phenylbutyl}-L-phenylalanyl-L-isoleucyl-L-phenylalaninamide

pdb file: 621955.pdb
sdf file: 621955.sdf
directory: 621955

AIDS-057818 AIDS057818 Boc-Phe-.phi.[(S)-CH(OH)CH2NH]Phe-Gln-Phe-NH2 N-{(2S,3S)-3-[(tert-Butoxycarbonyl)amino]-2-hydroxy-4-phenylbutyl}-L-phenylalanyl-L-glutaminyl-L-phenylalaninamide

pdb file: 621956.pdb
sdf file: 621956.sdf
directory: 621956

AIDS-057819 AIDS057819 Boc-Phe[CH(OH)CH2NH]Phe-Gln-Phe-NH2 N-{(2R,3S)-3-[(tert-Butoxycarbonyl)amino]-2-hydroxy-4-phenylbutyl}-L-phenylalanyl-L-glutaminyl-L-phenylalaninamide

pdb file: 621957.pdb
sdf file: 621957.sdf
directory: 621957

AIDS-057820 AIDS057820 Boc-Phe[CH(OH)CH2NH]Phe-Glu-Phe-NH2 N-{(2S,3S)-3-[(tert-Butoxycarbonyl)amino]-2-hydroxy-4-phenylbutyl}-L-phenylalanyl-L-.alpha.-glutamyl-L-phenylalaninamide

pdb file: 621958.pdb
sdf file: 621958.sdf
directory: 621958

AIDS-057821 AIDS057821 Boc-Phe[CH(OH)CH2NH]Phe-Glu-Phe-NH2 N-{(2R,3S)-3-[(tert-Butoxycarbonyl)amino]-2-hydroxy-4-phenylbutyl}-L-phenylalanyl-L-.alpha.-glutamyl-L-phenylalaninamide

pdb file: 621959.pdb
sdf file: 621959.sdf
directory: 621959

1-[(tert-Butoxycarbonyl)-L-phenylalanyl]-3-pyrrolidinone AIDS-058375 AIDS058375 Boc-Phe-3-Pyridinone deriv.

pdb file: 622504.pdb
sdf file: 622504.sdf
directory: 622504

1-[N-(2-Quinolinylcarboxamide)-L-phenylalanyl]-3-pyrrolidinone AIDS-058376 AIDS058376 Phe-3-Pyridinone deriv.

pdb file: 622505.pdb
sdf file: 622505.sdf
directory: 622505

1-[N-(Nicotinyl-3-carboxamide)-L-phenylalanyl]-3-pyrrolidinone AIDS-058377 AIDS058377 Phe-3-Pyridinone deriv.

pdb file: 622506.pdb
sdf file: 622506.sdf
directory: 622506

1-[N-(benzoyl-carboxamide)-L-phenylalanyl]-3-pyrrolidinone AIDS-058378 AIDS058378 Phe-3-Pyridinone deriv.

pdb file: 622507.pdb
sdf file: 622507.sdf
directory: 622507

1-[N-(N,N-diphenylcarbonyl)-L-phenylalanyl]-3-pyrrolidinone AIDS-058379 AIDS058379 Phe-3-Pyridinone deriv.

pdb file: 622508.pdb
sdf file: 622508.sdf
directory: 622508

1-[N-(N-methyl,N-phenylcarbonyl)-L-phenylalanyl]-3-pyrrolidinone AIDS-058380 AIDS058380 Phe-3-Pyridinone deriv.

pdb file: 622509.pdb
sdf file: 622509.sdf
directory: 622509

1-[N-(octyloxycarbonyl)-L-phenylalanyl]-3-pyrrolidinone AIDS-058381 AIDS058381 Phe-3-Pyridinone deriv.

pdb file: 622510.pdb
sdf file: 622510.sdf
directory: 622510

1-[N-(benzoyloxycarbonyl)-L-phenylalanyl]-3-pyrrolidinone AIDS-058382 AIDS058382 Phe-3-Pyridinone deriv.

pdb file: 622511.pdb
sdf file: 622511.sdf
directory: 622511

1-[(tert-Butoxycarbonyl)-L-phenylalanyl]-3-(RS)-pyrrolidinol AIDS-058474 AIDS058474 Boc-Phe-3-Pyridinone deriv.

pdb file: 622603.pdb
sdf file: 622603.sdf
directory: 622603

(N-t-Butyloxycarbonylphenylnorstatinyl)-phenylalanyl-leucine ethyl ester AIDS-059711 AIDS059711 Boc-(2S,3S)-AHPBA-Phe-Leu-OCH2CH3

pdb file: 623762.pdb
sdf file: 623762.sdf
directory: 623762

(N-t-Butyloxycarbonylphenylnorstatinyl)-phenylalanyl-leucine ethyl ester AIDS-059712 AIDS059712 Boc-(2R,3S)-AHPBA-Phe-Leu-OCH2CH3

pdb file: 623763.pdb
sdf file: 623763.sdf
directory: 623763

(N-t-Butyloxycarbonylphenylnorstatinyl)-phenylalanyl-leucine ethyl ester AIDS-059713 AIDS059713 Boc-(2S,3R)-AHPBA-Phe-Leu-OCH2CH3

pdb file: 623764.pdb
sdf file: 623764.sdf
directory: 623764

(N-t-Butyloxycarbonylphenylnorstatinyl)-phenylalanyl-leucine ethyl ester AIDS-059714 AIDS059714 Boc-(2R,3R)-AHPBA-Phe-Leu-OCH2CH3

pdb file: 623765.pdb
sdf file: 623765.sdf
directory: 623765

AIDS-059726 AIDS059726 Val-Val-Apns-Phe-Val-Val-NH2 Valyl-valyl-phenylnorstatyl-phenylalanyl-valyl-valinamide

pdb file: 623777.pdb
sdf file: 623777.sdf
directory: 623777

AIDS-060183 AIDS060183 Alanine, N-[9-(4-methoxyphenyl)-9H-purin-6-yl]phenylalanyl-2-methyl-, methyl ester NSC692661

pdb file: 624193.pdb
sdf file: 624193.sdf
directory: 624193

144285-78-9 AIDS-071509 AIDS071509 L-Valine, N-(N-(N-(2-((N-L-alanyl-L-alanyl)amino)-1-hydroxy-3-phenylpropyl)- -L-phenylalanyl)-L-valyl)-, methyl ester, (S-(R*,R*))- SKF 108738 heF

pdb file: 626829.pdb
sdf file: 626829.sdf
directory: 626829

144285-77-8 AIDS-071510 AIDS071510 L-Valine, N-(N-(N-(2-((N-L-alanyl-L-alanyl)amino)-1-hydroxy-3-phenylpropyl)- glycyl)-L-valyl)-, methyl ester, (S-(R*,R*))- SKF 107457 heG

pdb file: 626830.pdb
sdf file: 626830.sdf
directory: 626830

AIDS-072042 AIDS072042 N,N'-Bis-(L-phenylalanyl-L-valyl)-2S,5S-diamino-1,6-diphenylhexane-3R,4R-diol

pdb file: 627308.pdb
sdf file: 627308.sdf
directory: 627308

AIDS-072048 AIDS072048 N,N'-Bis-[D-gluconyl-L-phenylalanyl-L-valyl]-propionyl-L-valyl]-2S,5S-diamino-1,6-diphenylhexane-3R,4R-diol

pdb file: 627314.pdb
sdf file: 627314.sdf
directory: 627314

229030-20-0 AIDS-080411 AIDS080411 H-Arg-Ala-Nal-Cys-Tyr-Arg-Lys-DLys-Pro-Tyr-Arg-Cit-Cys-Arg-OH L-Arginine, L-arginyl-L-arginyl-3-(2-naphthalenyl)-L-alanyl-L-cysteinyl-L-tyrosyl-L-arginyl-L-lysyl-D-lysyl-L-prolyl-L-tyrosyl-L-arginyl-N5-(aminocarbonyl)-L-ornithyl-L-cysteinyl-, cyclic (4-13)-disulfide T 140 T-140 T140

pdb file: 629146.pdb
sdf file: 629146.sdf
directory: 629146

111710-61-3 AIDS-081104 AIDS081104 Cyclo[[(E)-(2S,3R,4R)-3-hydroxy-4-methyl-2-(methylamino)-6-octenoyl]-L-2-aminobutyryl-N-methylglycyl-N-methyl-L-leucyl-L-valyl-N-methyl-L-alanyl-L-alanyl-D-alanyl-N-methyl-L-leucyl-N-methyl-L-leucyl-N-methyl-L-valyl] Cyclosporin A, 11-(N-methyl-L-alanine)- [MeAla6]-CsA [MeAla]6-Ciclosporin [MeAla]6-CsA [MeAla]6-Cyclosporin

pdb file: 629739.pdb
sdf file: 629739.sdf
directory: 629739

83602-39-5 AIDS-081105 AIDS081105 Cyclo[L-alanyl-D-alanyl-N-methyl-L-leucyl-N-methyl-L-leucyl-N-methyl-D-valyl-(3R,4R,6E)-6,7-didehydro-3-hydroxy-N,4-dimethyl-L-2-aminooctanoyl-L-2-aminobutanoyl-N-methylglycyl-N-methyl-L-leucyl-L-valyl-N-methyl-L-leucyl] Cyclosporin A der. Cyclosporin A, 5-(N-methyl-D-valine)- Cyclosporin H Sandoz 37-839

pdb file: 629740.pdb
sdf file: 629740.sdf
directory: 629740

AIDS-081455 AIDS081455 Boc-Phe-His-CVD-Ile-Amp L-Histidinamide, N-[(1,1-dimethylethoxy)carbonyl]-L-phenylalanyl-N-[1-(cyclohexylmethy)-2,3-dihydroxy-5-methyl-4-[[[2-methyl-1-[[(2-pyridinylmethyl)amino]carbonyl]butyl]amino]carbonyl]hexyl]-, [1S-[1R*,2S*,3S*,4S*(1R*,2R*)]]-

pdb file: 630086.pdb
sdf file: 630086.sdf
directory: 630086

AIDS-081460 AIDS081460 Boc-Phe-His-LPA-Ile-Amp L-Histidinamide, N-[(1,1-dimethylethoxy)carbonyl]-L-phenylalanyl-N-[2-hydroxy-1-(2-methylpropyl)-5-[[2-methyl-1-[[(2-pyridinylmethyl)amino]carbonyl]butyl]amino]-5-oxo-4-(phenylmethyl)pentyl]-, [1S-[1R*,2R*,4S*,5(1R*,2R*)]]

pdb file: 630091.pdb
sdf file: 630091.sdf
directory: 630091

AIDS-081461 AIDS081461 Boc-Phe-His-LCA-Ile-Amp L-Histidinamide, N-[(1,1-dimethylethoxy)carbonyl]-L-phenylalanyl-N-[4-(cyclohexylmethy)-2-hydroxy-1-(2-methylpropyl)-5-[[2-methyl-1-[[(2-pyridinylmethyl)amino]carbonyl]butyl]amino]-5-oxopentyl]-, [1S-[1R*,2R*,4S*,5(1R*,2R*)]]-

pdb file: 630092.pdb
sdf file: 630092.sdf
directory: 630092

AIDS-081462 AIDS081462 Boc-Phe-His-CVD'-Ile-Amp L-Talonamide, 6-cyclohexyl-2,5,6-trideoxy-5-[N-[N-[(1,1-dimethylethoxy)carbonyl]-L-phenylalanyl]-2-L-histidyl]amino]-2-(1-methylethyl)-N-[2-methyl-1-[[(2-pyridinylmethyl)amino]carbonyl]butyl]-, [S-(R*,R*)]-

pdb file: 630093.pdb
sdf file: 630093.sdf
directory: 630093

AIDS-081467 AIDS081467 Dansyl-Phe-His-LVA-Ile-Amp L-Histidinamide, N-[[5-(dimethylamino)-1-naphthalenyl]sulfonyl]amino]-L-phenylalanyl-N-(2-hydroxy-5-methyl-1-(2-methylpropyl)-4-[[[2-methyl-1-[[(2-pyridinylmethyl)amino]carbonyl]butyl]amino]carbonyl]hexyl]-, [1S-[1R*,2R*,4R*(1R*,2R*)]]-

pdb file: 630098.pdb
sdf file: 630098.sdf
directory: 630098

AIDS-081474 AIDS081474 H-Phe-LVA-Ile-Amp L-Valinamide, L-phenylalanyl-N-[2-hydroxy-5-methyl-1-(2-methylpropyl)-4-[[[2-methyl-1-[[(2-pyridinylmethyl)amino]carbonyl]butyl]amino]carbonyl]hexyl]-, [1S-[1R*,2R*,4R*(1R*,2R*)]]-

pdb file: 630105.pdb
sdf file: 630105.sdf
directory: 630105

AIDS-081503 AIDS081503 Boc-Ala-CVA-Ile-Amp N-tert-Butyloxycarbonyl-L-alanyl-5S-amino-6-cyclohexyl-4S-hydroxy-2S-isopropyl-hexanoyl-L-isoleucyl-2-pyridylmethylamide

pdb file: 630134.pdb
sdf file: 630134.sdf
directory: 630134

AIDS-081507 AIDS081507 Benzyloxycarbonyl-L-alanyl-L-alanyl-5S-amino-6-cyclohexyl-4S-hydroxy-2S-isopropyl-hexanoyl-L-isoleucyl-2-pyridylmethylamide CBZ-Ala-Ala-CVA-Ile-Amp

pdb file: 630138.pdb
sdf file: 630138.sdf
directory: 630138

166445-47-2 AIDS-081658 AIDS081658 Cyclo[N-methyl-L-alanyl-L-alanyl-D-alanyl-N-methyl-L-leucyl-N-methyl-L-leucyl-N-methyl-L-valyl-(3R)-3-hydroxy-N-methyl-L-leucyl-(2S)-2-aminobutanoyl-N-methylglycyl-N-methyl-L-alanyl-L-valyl] [MeLeu(3-OH)1, MeAla4,6]-CsA

pdb file: 630289.pdb
sdf file: 630289.sdf
directory: 630289

187826-35-3 AIDS-081661 AIDS081661 CDR1.AME(17-22) FCTASQKKCY (Cyclized/Cysteine-oxidized) L-Tyrosine, L-phenylalanyl-L-cysteinyl-L-threonyl-L-alanyl-L-seryl-L-glutaminyl-L-lysyl-L-lysyl-L-cysteinyl-, cyclic (2==

pdb file: 630292.pdb
sdf file: 630292.sdf
directory: 630292

176434-87-0 AIDS-081662 AIDS081662 CDR1.AME(23-28) FCSIQFHWCY (Cyclized/Cysteine-oxidized) L-Tyrosine, L-phenylalanyl-L-cysteinyl-L-seryl-L-isoleucyl-L-glutaminyl-L-phenylalanyl-L-histidyl-L-tryptophyl-L-cysteinyl-, cyclic (2==

pdb file: 630293.pdb
sdf file: 630293.sdf
directory: 630293

187826-36-4 AIDS-081663 AIDS081663 CDR2.AME(39-44) FCNQGSFLCY (Cyclized/Cysteine-oxidized) L-Tyrosine, L-phenylalanyl-L-cysteinyl-L-asparaginyl-L-glutaminylglycyl-L-seryl-L-phenylalanyl-L-leucyl-L-cysteinyl-, cyclic (2==

pdb file: 630294.pdb
sdf file: 630294.sdf
directory: 630294

174490-49-4 AIDS-081664 AIDS081664 CDR2.AME(45-50) FCTKGPSKCY (Cyclized/Cysteine-oxidized) L-Tyrosine, L-phenylalanyl-L-cysteinyl-L-threonyl-L-lysylglycyl-L-prolyl-L-seryl-L-lysyl-L-cysteinyl-, cyclic (2==

pdb file: 630295.pdb
sdf file: 630295.sdf
directory: 630295

176434-88-1 AIDS-081665 AIDS081665 CDR2.AME(50-55) FCKLNDRACY (Cyclized/Cysteine-oxidized) L-Tyrosine, L-phenylalanyl-L-cysteinyl-L-lysyl-L-leucyl-L-asparaginyl-L-.alpha.-aspartyl-L-arginyl-L-alanyl-L-cysteinyl-, cyclic (2==

pdb file: 630296.pdb
sdf file: 630296.sdf
directory: 630296

174490-50-7 AIDS-081666 AIDS081666 CDR3AME(82-89) FCYICEVEDQCY (Cyclized/Cysteine-oxidized) L-Tyrosine, L-phenylalanyl-L-cysteinyl-L-tyrosyl-L-isoleucyl-L-cysteinyl-L-.alpha.-glutamyl-L-valyl-L-.alpha.-glutamyl-L-.alpha.-aspartyl-L-glutaminyl-L-cysteinyl-, cyclic (2 ==

pdb file: 630297.pdb
sdf file: 630297.sdf
directory: 630297

174490-51-8 AIDS-081667 AIDS081667 CDR3.AME(85-91) FCEVEDQKECY (Cyclized/Cysteine-oxidized) L-Tyrosine, L-phenylalanyl-L-cysteinyl-L-.alpha.-glutamyl-L-valyl-L-.alpha.-glutamyl-L-.alpha.-aspartyl-L-glutaminyl-L-lysyl-L-.alpha.-glutamyl-L-cysteinyl-, cyclic (2==

pdb file: 630298.pdb
sdf file: 630298.sdf
directory: 630298

187826-37-5 AIDS-081668 AIDS081668 CDR3.LIN(82-89) FCYICEVEDQCY (Linear) L-Tyrosine, L-phenylalanyl-L-cysteinyl-L-tyrosyl-L-isoleucyl-L-cysteinyl-L-.alpha.-glutamyl-L-valyl-L-.alpha.-glutamyl-L-.alpha.-aspartyl-L-glutaminyl-L-cysteinyl-

pdb file: 630299.pdb
sdf file: 630299.sdf
directory: 630299

187826-38-6 AIDS-081669 AIDS081669 CDR3.LIN(85-91) FCEVEDQKECY (Linear) L-Tyrosine, L-phenylalanyl-L-cysteinyl-L-.alpha.-glutamyl-L-valyl-L-.alpha.-glutamyl-L-.alpha.-aspartyl-L-glutaminyl-L-lysyl-L-.alpha.-glutamyl-L-cysteinyl-

pdb file: 630300.pdb
sdf file: 630300.sdf
directory: 630300

AIDS-082200 AIDS082200 N^4-Dimethylaminomethylene-1-[2',3'-dideoxy-5',6'-O-(N-.alpha.-tert-butoxycarbonyl-L-phenylalanyl)-.beta.-D-erythro-pentofuranosyl]cytosine

pdb file: 630829.pdb
sdf file: 630829.sdf
directory: 630829

AIDS-085257 AIDS085257 N-Methoxyalyl-L-prolyl-D-phenyalanyl-L-asparagyl-[(2S,3S)-3-amino-2-hydroxy-4-phenylbutyryl]-N-tert-butyl-L-proline Amide

pdb file: 631608.pdb
sdf file: 631608.sdf
directory: 631608

AIDS-085258 AIDS085258 N-Methoxyalyl-L-prolyl-L-phenyalanyl-L-asparagyl-[(2S,3S)-3-amino-2-hydroxy-4-phenylbutyryl]-N-tert-butyl-L-proline Amide

pdb file: 631609.pdb
sdf file: 631609.sdf
directory: 631609

AIDS-085263 AIDS085263 [4-(N-Methoxalyl-L-prolyl-D-phenylalanyl-.beta.-alaninamido)phenoxy]acetyl-L-asparagyl-[(2S,3S)-3-amino-2-hydroxy-4-phenylbutyryl]-N-tert-butyl-L-proline Amide

pdb file: 631614.pdb
sdf file: 631614.sdf
directory: 631614

(2R,4S,5S)-5-(N^.alpha.-tert-Butoxycarbonyl-L-phenylalanyl-L-asparaginyl)amino-6-cyclohexyl-4-hydroxy-2-methylhexanoate-n-butylamide AIDS-085932 AIDS085932

pdb file: 632255.pdb
sdf file: 632255.sdf
directory: 632255

(2R,4S,5S)-5-(N^.alpha.-tert-Butoxycarbonyl-L-phenylalanyl-L-valyl)amino-6-cyclohexyl-4-hydroxy-2-methylhexanoate-n-butylamide AIDS-085947 AIDS085947

pdb file: 632270.pdb
sdf file: 632270.sdf
directory: 632270

(2R,4S,5S)-5-(N^.alpha.-tert-Butoxycarbonyl-3-(1-naphthyl)-L-alanyl-L-valyl)amino-6-cyclohexyl-4-hydroxy-2-methylhexanoate-n-butylamide AIDS-085948 AIDS085948

pdb file: 632271.pdb
sdf file: 632271.sdf
directory: 632271

147664-63-9 (FREE BASE) 172820-23-4 (ACETATE) AIDS-086710 AIDS086710 Cytolex Glycyl-isoleucyl-glycyl-lysyl-phenylalanyl-leucyl-lysyl-lysyl-alanyl-lysyl-lysyl-phenylalanyl-glycyl-lysy--alanyl-phenylalanyl-valyl-lysyl-isoleucyl-leucyl-lysyl-lysinamide acetate L-Lysinamide, glycyl-L-isoleucylglycyl-L-lysyl-L-phenylalanyl-L-leucyl-L-lysyl-L-lysyl-L-alanyl-L-lysyl-L-lysyl-L-phenylalanylglycyl-L-lysyl-L-alanyl-L-phenylalanyl-L-valyl-L-lysyl-L-isoleucyl-L-leucyl-L-lysyl- Locilex MSI 78 MSI-78 Mangainin Pexiganan acetate

pdb file: 632991.pdb
sdf file: 632991.sdf
directory: 632991

AIDS-086767 AIDS086767 Poly-N-undec-10'-enoyl-L-phenylalanyl-.Beta.-alanine

pdb file: 633032.pdb
sdf file: 633032.sdf
directory: 633032

AIDS-086772 AIDS086772 Copoly-N-undec-10'-enoyl-L-phenylalanyl-undec-10'-enoyl-L-glutamic acid

pdb file: 633037.pdb
sdf file: 633037.sdf
directory: 633037

(S)-[(S)-2-Amino-3-(3-fluoro-phenyl)-propanoylamino]-[3,4-dihydroxy-5-(5-hydroxymethyl-2,4-dioxo-3,4-dihydro-2-H-pyrimidin-1-yl)-tetrahydro-furan-2-yl]-acetic acid AIDS-087997 AIDS087997 m-Fluorophenylalanyl-UPOC

pdb file: 634221.pdb
sdf file: 634221.sdf
directory: 634221

10-(4-Aminobutyl)-19-((2-amino-3-phenylpropanoyl)amino)-16-benzyl-7-(1-hydroxyethyl)-N-(2-hydroxy-1-(hydroxymethyl)propyl)-13-(1H-indol-3-ylmethyl)-6,9,12,15,18-pentaoxo-1,2-dithia-5,8,11,14,17-pentaa\tzacycloicosane-4-carboxamide acetate 83150-76-9 AIDS-088007 AIDS088007 L-Cysteinamide, D-phenylalanyl-L-cysteinyl-L-phenylalanyl-D-tryptophyl-L-lysyl-L- threonyl-N-(2-hydroxy-1-(hydroxymethyl)propyl)-, cyclic (2-

pdb file: 634231.pdb
sdf file: 634231.sdf
directory: 634231

AIDS-094144 AIDS094144 L-Phenylalanine, N-[(1S)-1-[[4-(1,1-dimethylethoxy)phenyl]methyl]-2-methoxy-2-oxoethyl]-D-alanyl-, phenylmethyl ester NSC672142

pdb file: 637210.pdb
sdf file: 637210.sdf
directory: 637210

155761-99-2 AIDS-096099 AIDS096099 L-Cysteine, L-phenylalanyl-L-leucylglycylglycyl-L-leucyl-L-isoleucyl-L-lysyl-- L-isoleucyl-L-valyl-L-prolyl-L-alanyl-L-methionyl-L-isoleucyl-L-c- ysteinyl-L-alanyl-L-valyl-L-threonyl-L-lysyl-L-lystyl-, cyclic(14-20)-disulfide Ranalexin

pdb file: 639005.pdb
sdf file: 639005.sdf
directory: 639005

136033-70-0 (S AND I) 136212-91-4 (GENERIC) AIDS-096163 AIDS096163 Dermaseptin Dermaseptin I Dermaseptin S L-Glutamine, L-alanyl-L-leucyl-L-tryptophyl-L-lysyl-L-threonyl-L-methionyl-L-leucyl-L-lysyl-L-lysyl-L-leucylglycyl-L-threonyl-L-methionyl-L-alanyl-L-leucyl-L-histidyl-L-alanylglycyl-L-lysyl-L-alanyl-L-alanyl-L-leucylglycyl-L-alanyl-L-alanyl-L-alanyl-L-.alpha.-aspartyl-L-threonyl-L-isoleucyl-L-seryl-L-glutaminylglycyl-L-threonyl-

pdb file: 639058.pdb
sdf file: 639058.sdf
directory: 639058

AIDS-097255 AIDS097255 [1S-[1R*,2S*(2S*,3R*)]-N-[3S-[[3-[[(1,1-Dimethylethoxy)carbonyl]amino]-2-hydroxy-4-phenylbutyl]amino]-2-hydroxy-1-(phenylmethyl)-propyl]-N,N-[(phenylmethoxy)carbonyl]-L-phenyl-alanyl]-L-valinamide

pdb file: 640104.pdb
sdf file: 640104.sdf
directory: 640104

AIDS-097280 AIDS097280 [S-(1R*,2S*)]-N,N'-[Iminobis[2-hydroxy-1-(phenylmethyl)-3,1-propanedinyl]bis[N,N-(L-phenylalanyl)-L-valinamide]

pdb file: 640129.pdb
sdf file: 640129.sdf
directory: 640129

AIDS-097283 AIDS097283 [S-[1R*,2S*(2S*,3R*)]-N-[3-[[3-[[(1,1-Dimethylethoxy)carbonyl]amino]-2-hydroxy-4-(phenylbutyl]amino]-2-hydroxy-1-(phenylmethyl)propyl]-N,N-(L-alanyl)-L-valinamide

pdb file: 640132.pdb
sdf file: 640132.sdf
directory: 640132

AIDS-097350 AIDS097350 [1R*,2S*(2S*,3R*)]-N-[3-[[3-[[(1,1-Dimethylethoxy) carbonyl]amino]-2-hydroxy-4-phenylbutyl]amino]-2-hydroxy-1-(phenylmethyl)propyl]-N,N-(2-hydroxyphenylalanyl)-L-valinamide

pdb file: 640199.pdb
sdf file: 640199.sdf
directory: 640199

AIDS-097413 AIDS097413 [1R*,2S*(2S*,3R*)]-N-[3-[[(1,1-Dimethyethoxy)carbonyl]amino]-2-hydroxy-4-phenylbutyl]amino]-2-hydrroxy-1-(phenylmethyl)propyl]-N,N-(N-formyl-L-alanyl)-3-methyl-L-valinamide

pdb file: 640262.pdb
sdf file: 640262.sdf
directory: 640262

AIDS-097414 AIDS097414 [1R*,2S*(2S*,3R*)]-N-[3-[[(1,1-Dimethylethoxy)carbonyl]amino]-2-hydroxy-4-phenylbutyl]amino]-2-hydroxy-1-(phenylmethyl)propyl]-N,N-(N-formyl-L-phenylalanyl)-3-methyl-L-valinamide

pdb file: 640263.pdb
sdf file: 640263.sdf
directory: 640263

AIDS-097716 AIDS097716 HCV NS3 protease inhibitor derived from substrate L-Leucinamide, N-(3-carboxy-1-oxopropyl)-L-.alpha.-aspartyl-L-.alpha.-glutamyl-2-methyl-L-phenylalanyl-3-methyl-L-valyl-N~1~-(1-borono-3-butenyl)-

pdb file: 640550.pdb
sdf file: 640550.sdf
directory: 640550

AIDS-105131 AIDS105131 Succ-D-E-Mef-Bgl-L-Abu-B(OH)2 Valinamide, N-(3-carboxy-1-oxopropyl)-L-.alpha.-aspartyl-L-.alpha.-glutamyl-3-methyl-L-phenylalanyl-N~1~-[(1S)-3-amino-3-borono-1-(2-methylpropyl)-2-oxo-5-hexenyl]-3-methyl-

pdb file: 642239.pdb
sdf file: 642239.sdf
directory: 642239

91464-97-0 AIDS-106202 AIDS106202 H-261 H261 L-Histidine, L-histidyl-L-prolyl-L-phenylalanyl-L-histidyl-(2S,4S,5S)-5-amino-4-hydroxy-7-methyl-2-(1-methylethyl)octanoyl-L-isoleucyl-

pdb file: 643290.pdb
sdf file: 643290.sdf
directory: 643290

AIDS-107157 AIDS107157 Cyclo(((E)-(2S,3R,4R)-3-hydroxy-4-methyl-2-(methylamino)-6-octenoyl)-L-2-aminobutyryl-N-methylglycyl-N--ethyl-L-leucyl-L-valyl-N-methyl-L-leucyl-L-alanyl-D-alanyl-N-methyl-L-leucyl-N-methyl-L-leucyl-N-methyl-L-valyl)

pdb file: 644221.pdb
sdf file: 644221.sdf
directory: 644221

AIDS-107158 AIDS107158 Cyclo(((E)-(2S,3R,4R)-3-hydroxy-4-methyl-2-(methylamino)-6-octenoyl)-L-2-aminobutyryl-N-methylglycyl-N--ethyl-L--valyl-L-valyl-N-methyl-L-leucyl-L-alanyl-D-alanyl-N-methyl-L-leucyl-N-methyl-L-leucyl-N-methyl-L-valyl)

pdb file: 644222.pdb
sdf file: 644222.sdf
directory: 644222

AIDS-107159 AIDS107159 Cyclo(((E)-(2S,3R,4R)-3-hydroxy-4-methyl-2-(methylamino)-6-octenoyl)-L-2-aminobutyryl-N-methylglycyl-N--ethyl-L--isoleucyl-L-valyl-N-methyl-L-leucyl-L-alanyl-D-alanyl-N-methyl-L-leucyl-N-methyl-L-leucyl-N-methyl-L-valyl)

pdb file: 644223.pdb
sdf file: 644223.sdf
directory: 644223

59787-61-0 AIDS-108971 AIDS108971 Cyclo[[(E)-(2S,3R,4R)-3-hydroxy-4-methyl-2-(methylamino)-6-octenoyl]-L-threonine-N-methylglycyl-N-methyl-L-leucyl-L-valyl-N-methyl-L-leucyl-L-alanyl-D-alanyl-N-methyl-L-leucyl-N-methyl-L-leucyl-N-methyl-L-valyl] Cyclosporin C [Thr2]CsA

pdb file: 645764.pdb
sdf file: 645764.sdf
directory: 645764

AIDS-108972 AIDS108972 Cyclo[[(E)-(2S,3R,4R)-3-hydroxy-4-methyl-2-(methylamino)-6-octenoyl]-L-2-aminobutyryl-N-O-acetyl-D-methyl-serine-N-methyl-L-leucyl-L-valyl-N-methyl-L-leucyl-L-alanyl-D-alanyl-N-methyl-L-leucyl-N-methyl-L-leucyl-N-methyl-L-valyl] [O-Acetyl-D-MeSer3]CsA

pdb file: 645765.pdb
sdf file: 645765.sdf
directory: 645765

AIDS-108973 AIDS108973 Cyclo[[(E)-(2S,3R,4R)-3-hydroxy-4-methyl-2-(methylamino)-6-octenoyl]-L-2-aminobutyryl-N-methylglycyl-N-methyl-L-leucyl-L-valyl-N-methyl-L-leucyl-L-alanyl-D-lysyl-N-methyl-L-leucyl-N-methyl-L-leucyl-N-methyl-L-valyl] [D-Lys]8-CsA

pdb file: 645766.pdb
sdf file: 645766.sdf
directory: 645766

AIDS-108974 AIDS108974 Cyclo[[(E)-(2S,3R,4R)-O-acetyl-4-methyl-Bmt-L-2-aminobutyryl-N-methylglycyl-N-methyl-L-leucyl-L-valyl-N-methyl-L-leucyl-L-alanyl-D-alanyl-N-methyl-L-leucyl-N-methyl-L-leucyl-N-methyl-L-valyl] [O-Acetyl-MeBmt]1-CsA

pdb file: 645767.pdb
sdf file: 645767.sdf
directory: 645767

AIDS-108975 AIDS108975 Cyclo[[(E)-(2S,3R,4R)-3-hydroxy-4-methyl-2-(methylamino)-6-octenoyl]-L-2-aminobutyryl-N--prolyl-N-methyl-L-leucyl-L-valyl-N-methyl-L-leucyl-L-alanyl-D-alanyl-N-methyl-L-leucyl-N-methyl-L-leucyl-N-methyl-L-valyl] [Proline]3-CsA

pdb file: 645768.pdb
sdf file: 645768.sdf
directory: 645768

AIDS-108976 AIDS108976 Cyclo[[(E)-(2S,3R,4R)-3-hydroxy-4-methyl-2-(methylamino)-6-octenoyl]-L-2-aminobutyryl-N--methylglycyl-N-thio-methyl-L-leucyl-L-valyl-N-methyl-L-leucyl-L-alanyl-D-alanyl-N-methyl-L-leucyl-N-methyl-L-leucyl-N-methyl-L-valyl] [Thio-MeLeu]4-CsA

pdb file: 645769.pdb
sdf file: 645769.sdf
directory: 645769

AIDS-108977 AIDS108977 Cyclo[[(E)-(2S,3R,4R)-3-hydroxy-4-methyl-2-(methylamino)-6-octenoyl]-L-2-aminobutyryl-N-methylglycyl-N-methyl-L-leucyl-L--leucyl-N-L-prolyl-L-alanyl-D-alanyl-N-methyl-L-leucyl-N-methyl-L-leucyl-N-methyl-L-valyl] [(Leu)5-(Pro)6]-CsA

pdb file: 645770.pdb
sdf file: 645770.sdf
directory: 645770

AIDS-108978 AIDS108978 Cyclo[[(E)-(2S,3R,4R)-3-hydroxy-4-methyl-2-(methylamino)-6-octenoyl]-L-2-aminobutyryl-N-methylglycyl-N-methyl-L-leucyl-L-valyl-N-methyl-L-leucyl-L-alanyl-D-alanyl-N-gamma-hydroxy-L-leucyl-N-methyl-L-leucyl-N-methyl-L-valyl] [gamma-Hydroxy-Leu]9-CsA

pdb file: 645771.pdb
sdf file: 645771.sdf
directory: 645771

AIDS-108979 AIDS108979 Cyclo[[(E)-(2S,3R,4R)-3-hydroxy-4-methyl-2-(methylamino)-6-octenoyl]-L-2-aminobutyryl-N-methylglycyl-N-methyl-L-leucyl-L-valyl-N-methyl-L-leucyl-L-alanyl-D-alanyl-N-methyl-L-leucyl-N-methyl-L-alanyl-N-methyl-L-valyl] [MeAla]10-CsA

pdb file: 645772.pdb
sdf file: 645772.sdf
directory: 645772

AIDS-108980 AIDS108980 Alanine, N-[(1,1-dimethylethoxy)carbonyl]phenylalanyl-3-[[2-[[(1,1-dimethylethoxy)carbonyl]amino]-1-oxo-3-phenylpropyl]amino]-

pdb file: 645773.pdb
sdf file: 645773.sdf
directory: 645773

AIDS-109290 AIDS109290 Boc-Phe-psi[CO N(OH)]-Phe-Pro-NH tBu D-Prolinamide, N-[(1,1-dimethylethoxy)carbonyl]-L-phenylalanyl-N-hydroxy-L-phenylalanyl-N-(1,1-dimethylethyl)-

pdb file: 646083.pdb
sdf file: 646083.sdf
directory: 646083

AIDS-109291 AIDS109291 D-Prolinamide, N-[(phenylmethoxy)carbonyl]-L-phenylalanyl-N-hydroxy-L-phenylalanyl-N-(1,1-dimethylethyl)- Z-Phe-psi[CO N(OH)]-Phe-Pro-NH tBu

pdb file: 646084.pdb
sdf file: 646084.sdf
directory: 646084

AIDS-109292 AIDS109292 D-Prolinamide, N-[(9H-fluoren-9-ylmethoxy)carbonyl]-L-phenylalanyl-N-hydroxy-L-phenylalanyl-N-(1,1-dimethylethyl)- Fmoc-Phe-psi[CO N(OH)]-Phe-Pro-NH tBu

pdb file: 646085.pdb
sdf file: 646085.sdf
directory: 646085

AIDS-109293 AIDS109293 D-Prolinamide, N-[(9H-fluoren-9-ylmethoxy)carbonyl]-L-phenylalanyl-N-hydroxy-D-phenylalanyl-N-(1,1-dimethylethyl)- Fmoc-Phe-psi[CO N(OH)]-D-Phe-Pro-NH tBu

pdb file: 646086.pdb
sdf file: 646086.sdf
directory: 646086

AIDS-109294 AIDS109294 D-Prolinamide, N-(3-hydroxy-2-methylbenzoyl)-L-phenylalanyl-N-hydroxy--L-phenylalanyl-N-(1,1-dimethylethyl)- Hmba-Phe-psi[CO N(OH)]-Phe-Pro-NH tBu

pdb file: 646087.pdb
sdf file: 646087.sdf
directory: 646087

AIDS-109295 AIDS109295 D-Prolinamide, N-hydroxy-N-(3-hydroxy-2-methylbenzoyl)-L-phenylalanyl-N-(1,1-dimethylethyl)- Hmba-psi[CO N(OH)]-Phe-Pro-NH tBu

pdb file: 646088.pdb
sdf file: 646088.sdf
directory: 646088

AIDS-109296 AIDS109296 D-Prolinamide, N-[(9H-fluoren-9-ylmethoxy)carbonyl]-L-phenylalanyl-N-hydroxyglycyl-N-(1,1-dimethylethyl)- Fmoc-Phe-psi[CO N(OH)]-Gly-Pro-NH tBu

pdb file: 646089.pdb
sdf file: 646089.sdf
directory: 646089

AIDS-109297 AIDS109297 D-Prolinamide, N-(3-hydroxy-2-methylbenzoyl)-L-phenylalanyl-N-hydroxyglycyl-N-(1,1-dimethylethyl)- Hmba-Phe-psi[CO N(OH)]-Gly-Pro-NH tBu

pdb file: 646090.pdb
sdf file: 646090.sdf
directory: 646090

AIDS-109299 AIDS109299 Fmoc-Phe-psi[CO N(OH)]-Gly-Phe-NH tBu L-Phenylalaninamide, N-[(9H-fluoren-9-ylmethoxy)carbonyl]-L-phenylalanyl-N-hydroxyglycyl-N-(1,1-dimethylethyl)-

pdb file: 646092.pdb
sdf file: 646092.sdf
directory: 646092

AIDS-109300 AIDS109300 Hmba-Phe-psi[CO N(OH)]-Gly-Phe-NH tBu L-Phenylalaninamide, N-(3-hydroxy-2-methylbenzoyl)-L-phenylalanyl-N-hydroxyglycyl-N-(1,1-dimethylethyl)-

pdb file: 646093.pdb
sdf file: 646093.sdf
directory: 646093

AIDS-110051 AIDS110051 L-.alpha.-Asparagine, N-(3-methylbutyl)-N-(2-methyl-1-oxopropyl)glycyl-L-valyl-L-isoleucyl-L-phenylalanyl-N1-(1-carboxypropyl)- iPr-C(=O)N(iBu)CH2C(=O)-VIFD-(+/-)Abu

pdb file: 646825.pdb
sdf file: 646825.sdf
directory: 646825

AIDS-110052 AIDS110052 L-.alpha.-Asparagine, N-(3-methoxy-1-oxopropyl)-L-isoleucyl-L-valyl-L-isoleucyl-L-phenylalanyl-N1-(1-carboxypropyl)- mPr-IVIFD-(+/-)Abu

pdb file: 646826.pdb
sdf file: 646826.sdf
directory: 646826

(iBu)2NCH2C(=O)-VIFD-(+/-)Abu AIDS-110053 AIDS110053 L-.alpha.-Asparagine, N,N-bis(2-methylpropyl)glycyl-L-valyl-L-isoleucyl-L-phenylalanyl-N1-(1-carboxypropyl)-

pdb file: 646827.pdb
sdf file: 646827.sdf
directory: 646827

(iBu)2NCH2C(=O)-VIFN-(+/-)Abu AIDS-110054 AIDS110054 L-Aspartamide, N,N-bis(2-methylpropyl)glycyl-L-valyl-L-isoleucyl-L-phenylalanyl-N1-(1-carboxypropyl)-

pdb file: 646828.pdb
sdf file: 646828.sdf
directory: 646828

AIDS-110057 AIDS110057 L-.alpha.-Asparagine, N-(3-methoxy-1-oxopropyl)-L-isoleucyl-L-valyl-L-isoleucyl-L-phenylalanyl-N1-[1-(methoxycarbonyl)propyl]- mPr-IVIFD-aBU(oMe)

pdb file: 646831.pdb
sdf file: 646831.sdf
directory: 646831

AIDS-110059 AIDS110059 Cholyl-FDP L-Proline, N-[(3a,5b,7a,12a)-3,7,12-trihydroxy-24-oxocholan-24-yl]-L-phenylalanyl-L-.alpha.-aspartyl-

pdb file: 646833.pdb
sdf file: 646833.sdf
directory: 646833

AIDS-110639 AIDS110639 L-Alaninamide, N-acetyl-L-.alpha.-aspartyl-L-.alpha.-glutamyl-3,3-diphenyl-L-alanyl-L-.alpha.-glutamyl-N1-[(1S)-1-carboxy-3,3-difluoropropyl]-3-cyclohexyl-

pdb file: 647393.pdb
sdf file: 647393.sdf
directory: 647393

AIDS-110642 AIDS110642 L-Alaninamide, N-acetyl-L-.alpha.-aspartyl-L-.alpha.-glutamyl-.beta.-phenyl-L-phenylalanyl-L-.alpha.-glutamyl-N1-[1-(carboxycarbonyl)-3,3-difluoropropyl]-3-cyclohexyl-

pdb file: 647396.pdb
sdf file: 647396.sdf
directory: 647396

AIDS-110643 AIDS110643 L-Alaninamide, N-acetyl-L-.alpha.-aspartyl-L-.alpha.-glutamyl-3,3-diphenyl-L-alanyl-L-.alpha.-glutamyl-3-cyclohexyl-N1-(3,3-difluoro-1-formylpropyl)-

pdb file: 647397.pdb
sdf file: 647397.sdf
directory: 647397

AIDS-110816 AIDS110816 N-[N-[N-[N-[3-(1,2,3,4-Tetrahydroisoquinolyl)carbonyl]-L-alanyl]-4(S)-amino-3(S)-hydroxy-5-cyclohexylpentanoyl]-L-leucyl]-L-phenylalaninamide THIQ-Ala-ACHPA-Leu-Phe-NH2.HCl

pdb file: 647569.pdb
sdf file: 647569.sdf
directory: 647569

AIDS-110817 AIDS110817 N-[N-[N-[N-[3-(1,2,3,4-Tetrahydroisoquinolyl)carbonyl]-L-valyl]-4(S)-amino-3(S)-hydroxy-5- cyclohexylpentanoyl]-L-alanyl]-L-phenylalaninamide THIQ-Val-ACHPA-Ala-Phe-NH2.HCl

pdb file: 647570.pdb
sdf file: 647570.sdf
directory: 647570

AIDS-110818 AIDS110818 N-[N-[N-[N-[3-(1,2,3,4-Tetrahydroisoquinolyl)carbonyl]-L-alanyl]-4(S)-amino-3(S)-hydroxy-5-cyclohexylpentanoyl]-L-leucyl]-L-phenylalanine THIQ-Ala-ACHPA-Leu-Phe-OH.HCl

pdb file: 647571.pdb
sdf file: 647571.sdf
directory: 647571

3'-Fluoro-3'-deoxythymidine, 5'-phosphoric acid, 2,2,2-trichloro-ethyl) ester, methyl-alanyl amidate AIDS-111321 AIDS111321 FdT-prodrug

pdb file: 648036.pdb
sdf file: 648036.sdf
directory: 648036

3'-Fluoro-3'-deoxythymidine, 5'-phosphoric acid, bis-(methyl-phenylalanyl amidate) AIDS-111355 AIDS111355 FdT-prodrug

pdb file: 648070.pdb
sdf file: 648070.sdf
directory: 648070

AIDS-112861 AIDS112861 Methioninamide, N-[(1,1-dimethylethoxy)carbonyl]-.alpha.-glutamylphenylalanylphenylalanylprolylleucyl- NSC647623

pdb file: 649380.pdb
sdf file: 649380.sdf
directory: 649380

AIDS-112884 AIDS112884 Glycinamide, N-[(1,1-dimethylethoxy)carbonyl]valylalanylprolylglycylvalyl-N1-methyl- NSC668010

pdb file: 649402.pdb
sdf file: 649402.sdf
directory: 649402

AIDS-112887 AIDS112887 NSC668904 Prolinamide, 5-oxoprolylalanyl-

pdb file: 649405.pdb
sdf file: 649405.sdf
directory: 649405

AIDS-113546 AIDS113546 Cbz-(2-Nal)-Leu-Leu-H L-Leucinamide, 3-(2-naphthalenyl)-N-[(phenylmethoxy)carbonyl]-L-alanyl-N1-[(1S)-1-formyl-3-methylbutyl]-

pdb file: 650151.pdb
sdf file: 650151.sdf
directory: 650151

AIDS-114686 AIDS114686 Histidine, N-[[1-cyclohexyl-2-(3-furanyl)-1H-benzimidazol-5-yl]carbonyl]-b-alanyl-

pdb file: 651115.pdb
sdf file: 651115.sdf
directory: 651115

AIDS-115665 AIDS115665 L-Leucinamide, N-(2-carboxy-4,5-dichlorobenzoyl)-2-cyclohexyl-D-alanyl-N1-[(1R)-1-[2-[[2-[[(S)-carboxyphenylmethyl]amino]-2-oxoethyl]amino]-1,2-dioxoethyl]butyl]-

pdb file: 651995.pdb
sdf file: 651995.sdf
directory: 651995

AIDS-115666 AIDS115666 L-Leucinamide, 2-cyclohexyl-N-(3,3-dimethyl-1-oxobutyl)-D-alanyl-N1-[(1R)-1-[2-[[2-[[(S)-carboxyphenylmethyl]amino]-2-oxoethyl]amino]-1,2-dioxoethyl]butyl]-

pdb file: 651996.pdb
sdf file: 651996.sdf
directory: 651996

AIDS-115667 AIDS115667 L-Leucinamide, N-(methylsulfonyl)leucyl-2-cyclohexyl-D-alanyl-N1-[(1R)-1-[2-[[2-[[(S)-carboxyphenylmethyl]amino]-2-oxoethyl]amino]-1,2-dioxoethyl]butyl]-

pdb file: 651997.pdb
sdf file: 651997.sdf
directory: 651997

AIDS-115668 AIDS115668 L-Leucinamide, N-[4-(aminosulfonyl)benzoyl]-2-cyclohexyl-D-alanyl-N1-[(1R)-1-[2-[[2-[[(S)-carboxyphenylmethyl]amino]-2-oxoethyl]amino]-1,2-dioxoethyl]butyl]-

pdb file: 651998.pdb
sdf file: 651998.sdf
directory: 651998

AIDS-115669 AIDS115669 L-Leucinamide, N-(2-carboxy-3,4,5,6-tetrafluorobenzoyl)-2-cyclohexyl-D-alanyl-N1-[(1R)-1-[2-[[2-[[(S)-carboxyphenylmethyl]amino]-2-oxoethyl]amino]-1,2-dioxoethyl]butyl]-

pdb file: 651999.pdb
sdf file: 651999.sdf
directory: 651999

AIDS-115754 AIDS115754 cis-1,6,3-t-Butoxycarbonyl-4-[(2S, 3S)-2-hydroxy-3-(N-quinaldyl-3-cyano-L-alanyl)amino-4-phenylbutyl]-3,4-diaza-bicyclo-[4.4.0]decane

pdb file: 652084.pdb
sdf file: 652084.sdf
directory: 652084

AIDS-121824 AIDS121824 L-Alaninamide, N-acetyl-.beta.-phenyl-L-phenylalanyl-L-.alpha.-glutamyl-N1-[(1S)-1-(carboxycarbonyl)-3,3-difluoropropyl]-3-cyclohexyl-

pdb file: 653116.pdb
sdf file: 653116.sdf
directory: 653116

AIDS-121825 AIDS121825 L-Alaninamide, N-acetyl-.beta.-phenyl-L-phenylalanyl-L-.alpha.-glutamyl-3-cyclohexyl-N1-[(1S)-3,3-difluoro-1-formylpropyl]-

pdb file: 653117.pdb
sdf file: 653117.sdf
directory: 653117

AIDS-121826 AIDS121826 L-Alaninamide, N-acetyl-.beta.-phenyl-L-phenylalanyl-L-.alpha.-glutamyl-N1-[(1S)-1-carboxy-3,3-difluoropropyl]-3-cyclohexyl-

pdb file: 653118.pdb
sdf file: 653118.sdf
directory: 653118

AIDS-121838 AIDS121838 L-leucinamide, N-[(1,1-dimethylethoxy)carbonyl]-L-alanyl-N1-[(1S)-1-(carboxycarbonyl)-3,3-difluoropropyl]-

pdb file: 653130.pdb
sdf file: 653130.sdf
directory: 653130

3303-55-7 L-Leucine, N-L-phenylalanyl- L-Phenylalanyl-L-leucine Phe-leu Phenylalanylleucine

pdb file: 653873.pdb
sdf file: 653873.sdf
directory: 653873

687-69-4 Alanylglycine EINECS 211-699-9 Glycine, N-L-alanyl- (8CI)(9CI) L-Alanylglycine N-L-Alanylglycine NSC 89597

pdb file: 656104.pdb
sdf file: 656104.sdf
directory: 656104

10-(alpha-Diethylaminopropionyl)phenothiazine 10-N,N-Diethylalanylphenothiazine 10H-Phenothiazine, 10-(2-(diethylamino)-1-oxopropyl)- 13012-66-3 4-27-00-01276 (Beilstein Handbook Reference) BRN 0035496 Phenothiazine, 10-N,N-diethylalanyl-

pdb file: 659969.pdb
sdf file: 659969.sdf
directory: 659969

13116-21-7 EINECS 236-042-3 N-(N-Glycyl-3-phenyl-L-alanyl)-3-phenyl-L-alanine

pdb file: 660070.pdb
sdf file: 660070.sdf
directory: 660070

13425-94-0 Asalin Asaline Ethyl ester of N-acetyl-DL-sarcolysyl-DL-valine L-Valine, N-(N-acetyl-4-(bis(2-chloroethyl)amino)phenylalanyl)-, ethyl ester (9CI) N-Acetyl-sarcolysil valine ethyl ether N-Acetylsarcolysylvaline Valine, N-(N-acetyl-3-(p-(bis(2-chloroethyl)amino)phenyl)alanyl)-, ethyl ester Valine, N-(N-acetyl-4-(bis(2-chloroethyl)amino)phenylalanyl)-, ethyl ester (9CI)

pdb file: 660346.pdb
sdf file: 660346.sdf
directory: 660346

1-L-Alanyl-L-proline 13485-59-1 Alanylproline EINECS 236-795-8 NSC 97932

pdb file: 660431.pdb
sdf file: 660431.sdf
directory: 660431

37415-62-6 4-Hexenoic acid, 6-(1,3-dihydro-4-hydroxy-6-methoxy-7-methyl-3-oxo-5-isobenzofuranyl)-4-methyl-, monosodium salt, (E)- (9CI) 4-Hexenoic acid, 6-(4-hydroxy-6-methoxy-7-methyl-3-oxo-5-phthalanyl)-4-methyl-, sodium salt ERL 080 Mycophenolate sodium Mycophenolate sodium [USAN] Mycophenolic acid monosodium salt Mycophenolic acid, sodium salt Mycophenolic monosodium salt NSC 116072 Sodium 4(E)-6-(4-hydroxy-6-methoxy-7-methyl-3-oxo-1,3-dihydroisobenzofuran-5-yl)-4-methylhex-4-enoate Sodium mycophenolate

pdb file: 660754.pdb
sdf file: 660754.sdf
directory: 660754

127678-91-5 1H-Thieno(3,4-d)imidazole-4-pentanamide, N-(2-((3-diazo-1-methyl-2-oxopropyl)amino)-2-oxo-1-(phenylmethyl)ethyl)hexahydro-2-oxo-, (3aS-(3aalpha,4beta(R*(R*)),6aalpha))- Bio-phe-ala-chn2 Biotin-phe-ala-dmk Biotin-phenylalanyl-alanine diazomethyl ketone Biotinyl-phe-ala-diazomethane Biotinyl-phenylalanyl-alanyl-diazomethane

pdb file: 660805.pdb
sdf file: 660805.sdf
directory: 660805

142009-30-1 1H-Thieno(3,4-d)imidazole-4-pentanamide, N-(3-chloro-2-oxo-1-(phenylmethyl)propyl)hexahydro-2-oxo-, (3aS-(3aalpha,4beta(R*),6aalpha))- Bio-phe-CH2Cl Biotinylphenylalanylchloromethane

pdb file: 660816.pdb
sdf file: 660816.sdf
directory: 660816

153512-31-3 1H-Thieno(3,4-d)imidazole-4-pentanamide, N-(2-((2-(diazomethyl)-2-oxo-1-(((phenylmethyl)thio)methyl)ethyl)amino)-2-oxo-1-(phenylmethyl)ethyl)hexahydro-2-oxo-, (3aS-(3aalpha,4beta(R*(S*)),6aalpha))- Biotin-phe-cys(sbzyl)-chn2 Biotin-phenylalanyl-(S-benzyl)cysteinyl-diazomethane

pdb file: 660820.pdb
sdf file: 660820.sdf
directory: 660820

15893-46-6 L-Phe-L-phe-amide L-Phenylalaninamide, L-phenylalanyl- L-Phenylalanine-L-phenylalanylamide Phe-phe-amide Phenylalanylphenylalanylamide

pdb file: 662023.pdb
sdf file: 662023.sdf
directory: 662023

16305-75-2 EINECS 240-392-2 N-L-Alanyl-L-tryptophan

pdb file: 662217.pdb
sdf file: 662217.sdf
directory: 662217

14486-05-6 EINECS 238-488-4 L-Alanyl-L-methionine

pdb file: 662598.pdb
sdf file: 662598.sdf
directory: 662598

16012-70-7 EINECS 240-149-0 L-Alanyl(benzyloxycarbonyl)-L-alanine

pdb file: 662803.pdb
sdf file: 662803.sdf
directory: 662803

19245-85-3 Acetyltrialanine EINECS 242-912-3 L-Alanine, N-(N-(N-acetyl-L-alanyl)-L-alanyl)- N-Acetyl-N-L-alanyl-N-L-alanyl-L-alanine

pdb file: 664794.pdb
sdf file: 664794.sdf
directory: 664794

112710-37-9 L-Phenylalanine, N-beta-alanyl-4-(bis(2-chloroethyl)amino)- Melphalan, beta-alanyl- N-beta-Alanyl-4-(bis(2-chloroethyl)amino)-L-phenylalanine beta-Alanylmelphalan

pdb file: 664932.pdb
sdf file: 664932.sdf
directory: 664932

1-(1-L-Alanyl-L-prolyl)-L-proline 22049-75-8 EINECS 244-755-6

pdb file: 667457.pdb
sdf file: 667457.sdf
directory: 667457

28540-82-1 Cyclo(N-methyl-L-alanyl-L-leucyl-alpha,beta-didehydro-N-methylphenylalanylglycyl), (Z)- Cycloleucyl-N-methylalanylglycyl-N-methyl dehydrophenylalanine Tentoxin

pdb file: 668366.pdb
sdf file: 668366.sdf
directory: 668366

35597-43-4 Antibiotic SF 1293 Bialaphos Bilanafos L-Alanine, 4-(hydroxymethylphosphinyl)-L-2-aminobutanoyl-L-alanyl- L-Alanine, gamma-(hydroxymethylphosphinyl)-L-alpha-aminobutyryl-L-alanyl- Phosphinothricylalanylalanine gamma-(Hydroxymethylphosphinyl)-L-alpha-aminobutyryl-L-alanyl-L-alanine

pdb file: 668398.pdb
sdf file: 668398.sdf
directory: 668398

56353-15-2 EINECS 260-123-2 N-(N-Acetyl-beta-alanyl)-L-histidine N-Acetylcarnosine

pdb file: 668625.pdb
sdf file: 668625.sdf
directory: 668625

121062-08-6 L-Lysinamide, N-acetyl-L-norleucyl-L-alpha-aspartyl-L-histidyl-D-phenylalanyl-L-arginyl-L-tryptophyl-, cyclic (2-7)-peptide Melanotan-II

pdb file: 669318.pdb
sdf file: 669318.sdf
directory: 669318

130289-71-3 Cetrorelix D-Alaninamide, N-acetyl-3-(2-naphthalenyl)-D-alanyl-4-chloro-D-phenylalanyl-3-(3-pyridinyl)-D-alanyl-L-seryl-L-tyrosyl-N(sup 5)-aminocarbonyl)-D-ornithyl-L-leucyl-L-arginyl-L-prolyl-, mono(trifluoroacetate) (salt) D-Alaninamide, N-acetyl-3-(2-naphthalenyl)-D-alanyl-4-chloro-D-phenylalanyl-3-(3-pyridinyl)-D-alanyl-L-seryl-L-tyrosyl-N5-(aminocarbonyl)-D-ornithyl-L-leucyl-L-arginyl-L-prolyl-, mono(trifluoroacetate) (salt) SB-75

pdb file: 669627.pdb
sdf file: 669627.sdf
directory: 669627

52299-14-6 EINECS 257-823-5 L-Alaninamide, N-(3-carboxy-1-oxopropyl)-L-alanyl-L-alanyl-N-(4-nitrophenyl)- N-(3-Carboxypropionyl)-L-alanyl-L-alanyl-N-(p-nitrophenyl)-L-alaninamide Succinyl-trialanine-4-nitroanilide

pdb file: 670243.pdb
sdf file: 670243.sdf
directory: 670243

3577-89-7 Asalex Asaley Ethyl ester of N-acetyl-DL-sarcolysyl-L-leucine L-Leucine, N-(N-acetyl-4-(bis(2-chloroethyl)amino)-DL-phenylalanyl)-, ethyl ester (9CI) Leucine sarcolysine Leucine, N-(N-acetyl-3-(p-(bis(2-chloroethyl)amino)phenyl)-DL-alanyl)-, ethyl ester, L- Leucine, N-(N-acetyl-3-(p-(bis(2-chloroethyl)amino)phenyl)-DL-alanyl)-, ethyl ester, L- (8CI) N-(N-Acetyl-4-bis(2-chloroethyl)amino)-dl-phenylalanyl-L-leucine ethyl ester N-Acetyl-DL-sarcolysyl-L-leucine ethyl ester NSC 167780

pdb file: 671329.pdb
sdf file: 671329.sdf
directory: 671329

1948-31-8 EINECS 217-751-7 N-L-Alanyl-L-alanine

pdb file: 673995.pdb
sdf file: 673995.sdf
directory: 673995

3146-40-5 EINECS 221-559-9 N-(N-L-Alanylglycyl)glycine

pdb file: 673997.pdb
sdf file: 673997.sdf
directory: 673997

3303-45-5 EINECS 221-978-7 N-L-Alanyl-L-valine

pdb file: 673998.pdb
sdf file: 673998.sdf
directory: 673998

3303-34-2 EINECS 221-977-1 N-L-Alanyl-L-leucine

pdb file: 674000.pdb
sdf file: 674000.sdf
directory: 674000

3061-90-3 Ala-phe Alanylphenylalanine L-Alanyl-L-phenylalanine L-Phenylalanine, N-L-alanyl- (9CI) NSC 89630

pdb file: 674013.pdb
sdf file: 674013.sdf
directory: 674013

4661-30-7 5513-69-9 Carbobenzoxy-gly-phe-amide Carbobenzoxyglycylphenylalanine amide Cbz-gly-phe-amide L-Phenylalaninamide, N-((phenylmethoxy)carbonyl)glycyl- N-Benzyloxycarbonyl-gly-phe-amide N-Carbobenzoxyglycyl-L-phenylalanylamide Z-Gly-phe-NH2

pdb file: 674018.pdb
sdf file: 674018.sdf
directory: 674018

3062-19-9 EINECS 221-306-2 N-DL-Alanyl-DL-serine

pdb file: 674020.pdb
sdf file: 674020.sdf
directory: 674020

2325-18-0 Alanylnorvaline DL-Norvaline, N-DL-alanyl- EINECS 219-038-6 N-DL-Alanyl-DL-norvaline NSC 89661

pdb file: 674021.pdb
sdf file: 674021.sdf
directory: 674021

42538-55-6 Glycine, N-(N-beta-alanylglycyl)- NSC 97931 beta-Ala-gly-gly beta-Alanyl-glycyl-glycine

pdb file: 674253.pdb
sdf file: 674253.sdf
directory: 674253

1999-45-7 EINECS 217-885-6 N-DL-Alanyl-DL-3-phenylalanine

pdb file: 674574.pdb
sdf file: 674574.sdf
directory: 674574

4892-10-8 L-Phenylalanine, N-(N-((phenylmethoxy)carbonyl)-L-phenylalanyl)-, methyl ester N-(Benzyloxycarbonyl)phenylalanylphenylalanine methyl ester NSC 120038 Z-Phe-phe-ome

pdb file: 674599.pdb
sdf file: 674599.sdf
directory: 674599

13122-99-1 Carbobenzoxyphenylalanylglycine EINECS 236-052-8 N-(N-((Phenylmethoxy)carbonyl)-L-phenylalanyl)glycine NSC 76846

pdb file: 675354.pdb
sdf file: 675354.sdf
directory: 675354

2768-53-8 3-Phenyl-N-(N-((phenylmethoxy)carbonyl)-L-alanyl)-L-alanine EINECS 220-454-5

pdb file: 675451.pdb
sdf file: 675451.sdf
directory: 675451

721-90-4 Glycine, N-L-phenylalanyl- N-L-Phenylalanylglycine NSC 126855 NSC 89182

pdb file: 675471.pdb
sdf file: 675471.sdf
directory: 675471

4294-26-2 Glycine, N-DL-phenylalanyl- L-Phenylalanylglycine NSC 89183 Phe-gly Phenylalanylglycine

pdb file: 675472.pdb
sdf file: 675472.sdf
directory: 675472

(S)-Benzyl (1-benzyl-3-chloro-2-oxopropyl)carbamate 26049-94-5 Carbamic acid, ((1S)-3-chloro-2-oxo-1-(phenylmethyl)propyl)-, phenylmethyl ester Carbamic acid, (3-chloro-2-oxo-1-(phenylmethyl)propyl)-, phenylmethyl ester, (S)- (9CI) EINECS 247-432-8 L-(alpha-(Chloroacetyl)phenethyl)carbamic acid, benzyl ester L-Carbobenzyloxyphenylalanyl chloromethyl ketone N(alpha)-Benzyloxycarbonylphenylalanylchloromethane N-((Benzyloxy)carbonyl)-L-phenylalanine chloromethyl ketone N-Carbobenzoxy-L-phenylalanyl-chloromethyl ketone NSC 251810 ZPCK

pdb file: 676980.pdb
sdf file: 676980.sdf
directory: 676980

(N(5)-Phosphono)-met-S-sulfoximinyl-ala-ala (N(5)-Phosphono)methionine-S-sulfoximinyl-alanyl-alanine 41928-08-9 L-(N5-Phosphono)methionine-S-sulfoximinyl-L-alanyl-L-alanine L-Alanine, 4-(S-methyl-N-phosphonosulfonimidoyl)-L-2-aminobutanoyl-L-alanyl- NSC 183742 PHOSPHONO-METHIONINE-S-SULFOXIMINYL-L-ALANYL-ALANINE

pdb file: 677068.pdb
sdf file: 677068.sdf
directory: 677068

19701-83-8 AMAA N-Acetyl-L-alanine N'-methylamide N-Acetyl-L-alanine methylamide N-Acetyl-N'-methylalaninamide N-Acetyl-ala-N-methylamide N-Acetylalanine N-methylamide N-Acetylalanine methylamide N-Acetylalanyl-N'-methylamide N-Acetylalanyl-N-methylamide NSC 186894 Propanamide, 2-(acetylamino)-N-methyl-, (S)- (9CI) Propionamide, 2-acetamido-N-methyl-, L- (8CI)

pdb file: 677073.pdb
sdf file: 677073.sdf
directory: 677073

20727-65-5 Ala-asp Alanylaspartic acid L-Aspartic acid, N-L-alanyl- NSC 186912

pdb file: 677078.pdb
sdf file: 677078.sdf
directory: 677078

19526-09-1 Frangufoline L-Leucinamide, N,N-dimethyl-L-phenylalanyl-(3S)-3-hydroxy-L-leucyl-N-(2-(4-hydroxyphenyl)ethenyl)-, cyclic (2-3)-ether

pdb file: 677180.pdb
sdf file: 677180.sdf
directory: 677180

26488-24-4 Cyclo(D-phenylalanyl-L-prolyl) Cyclo(L-prolyl-D-phenylalanyl) NSC 255998 Phe-pro-diketopiperazine Phenylalanyl-prolyl diketopiperazine Pyrrolo(1,2-a)pyrazine-1,4-dione, hexahydro-3-(phenylmethyl)-, (3R-cis)-

pdb file: 677265.pdb
sdf file: 677265.sdf
directory: 677265

13123-00-7 EINECS 236-053-3 L-Valine, N-(N-((phenylmethoxy)carbonyl)-L-phenylalanyl)- N-(N-((Benzoyloxy)carbonyl)-L-phenylalanyl)-L-valine N-Benzyloxycarbonylphenylalanyl-valine

pdb file: 677432.pdb
sdf file: 677432.sdf
directory: 677432

65189-71-1 Glycine, N-(N-(N-(N-(N2-(N2-L-leucyl-L-arginyl)-L-arginyl)-L-alanyl)-L-seryl)-L-leucyl)- Kemptide Leu-arg-arg-ala-ser-leu-gly Leucyl-arginyl-arginyl-alanyl-seryl-leucyl-glycine

pdb file: 677459.pdb
sdf file: 677459.sdf
directory: 677459

15483-58-6 Ac-Ala-ala-ala-ala Acetyl-L-alanyl-L-alanyl-L-alanyl-L-alanine Acetylalanyl-alanyl-alanyl-alanine L-Alanine, N-(N-(N-(N-acetyl-L-alanyl)-L-alanyl)-L-alanyl)- NSC 333574

pdb file: 677469.pdb
sdf file: 677469.sdf
directory: 677469

13126-07-3 Carbobenzoxyphenylalanylmethionine Cbz-phe-ala-met Cbz-phe-met L-Methionine, N-(N-((phenylmethoxy)carbonyl)-L-phenylalanyl)- NSC 334019 Nalpha-Carbobenzoxy-L-phenylalanyl-L-methionine

pdb file: 677475.pdb
sdf file: 677475.sdf
directory: 677475

1-(N-((Phenylmethoxy)carbonyl)-L-phenylalanyl)-L-proline 7669-64-9 EINECS 231-645-8

pdb file: 677476.pdb
sdf file: 677476.sdf
directory: 677476

17922-87-1 Gly-L-ala-L-phe Gly-ala-phe Glycyl-alanyl-phenylalanine L-Phenylalanine, N-(N-glycyl-L-alanyl)-

pdb file: 677481.pdb
sdf file: 677481.sdf
directory: 677481

3786-08-1 EINECS 223-254-6 N-(N-Acetyl-3-phenyl-L-alanyl)-3,5-diiodo-L-tyrosine N-Acetylphenylalanyl-3,5-diiodotyrosine NSC 334284

pdb file: 677486.pdb
sdf file: 677486.sdf
directory: 677486

26910-17-8 EINECS 248-101-0 Methyl-N-acetyl-N-L-alanyl-N-L-alanyl alaninate

pdb file: 677506.pdb
sdf file: 677506.sdf
directory: 677506

22849-49-6 Gly-ala-leu Glycyl-alanyl-leucine L-Leucine, N-(N-glycyl-L-alanyl)-

pdb file: 677518.pdb
sdf file: 677518.sdf
directory: 677518

10030-31-6 EINECS 233-078-1 N-(N-Acetyl-3-phenyl-L-alanyl)-3-phenyl-L-alanine

pdb file: 677523.pdb
sdf file: 677523.sdf
directory: 677523

60117-24-0 Enkephalinamide, leu- Enkephalinamide-leu L-Leucinamide, L-tyrosylglycylglycyl-L-phenylalanyl- Leu-enkephalinamide Leucine enkephalinamide

pdb file: 677557.pdb
sdf file: 677557.sdf
directory: 677557

2-Ala-met-enkephalinamide 61090-95-7 D-Enkephalin DALA DAME Dalamid Dalamide Enkephalinamide-met, ala(2)- Enkephalinamide-met, alanine(2)- L-Methioninamide, L-tyrosyl-D-alanylglycyl-L-phenylalanyl- Met-enkephalinamide, ala(2)- Methionine-enkephalinamide, ala(2)- d-Ala2-met5-enkephalinamide

pdb file: 677558.pdb
sdf file: 677558.sdf
directory: 677558

64963-01-5 EINECS 265-291-0 N-(N-(N-(N-L-Tyrosyl-D-alanyl)glycyl)-L-phenylalanyl)-L-leucine

pdb file: 677601.pdb
sdf file: 677601.sdf
directory: 677601

926-79-4 Alanyl-alanyl-alanyl-alanine EINECS 213-145-1 N-L-Alanyl-N-L-alanyl-N-L-alanyl-L-alanine

pdb file: 679990.pdb
sdf file: 679990.sdf
directory: 679990

3235-17-4 EINECS 221-791-0 N-(N-((Phenylmethoxy)carbonyl)-L-alanyl)glycine

pdb file: 680455.pdb
sdf file: 680455.sdf
directory: 680455

3253-17-6 Alanylhistidine EINECS 221-845-3 N-L-Alanyl-L-histidine

pdb file: 680457.pdb
sdf file: 680457.sdf
directory: 680457

2,4,5-Trichlorophenyl N-(N-((1,1-dimethylethoxy)carbonyl)-L-alanyl)glycinate 53054-11-8 EINECS 258-330-8

pdb file: 681809.pdb
sdf file: 681809.sdf
directory: 681809

(D-Ala(2)-mephe(4)-gly-ol(5))enkephalin 2-Ala-4-mephe-5-gly-enkephalin 78123-71-4 Ala(2)-mephe(4)-gly-ol(5) enkephalin DAGO DAMGE DAMGO Dagol Enkephalin, Ala(2)-MePhe(4)-Gly-ol(5)- Enkephalin, ala(2)-mephe(4)-gly(5)- Enkephalin, alanyl(2)-methylphenylalanyl(4)-glycine(5)- L-Phenylalaninamide, L-tyrosyl-D-alanylglycyl-N-(2-hydroxyethyl)-Nalpha-methyl- RX 783006 Tyr-ala-gly-(nme)phe-gly-ol glyol

pdb file: 682161.pdb
sdf file: 682161.sdf
directory: 682161

(D-Pen(2),D-pen(5))enkephalin 2,5-Pen-enkephalin 88381-29-7 Bis-pen-enkephalin Bis-penicillamine-enkephalin D-Valine, 3-mercapto-N-(N-(N-(3-mercapto-N-L-tyrosyl-D-valyl)glycyl)-L-phenylalanyl)- D-Valine, L-tyrosyl-3-mercapto-D-valylglycyl-L-phenylalanyl-3-mercapto-, cyclic (2-5)-disulfide DPDPE DPLPE Dpdpe(SH)2 Enkephalin, pen(2,5)- Enkephalin, penicillamine(2,5)- LY 198572 Pen(2),pen(5)-enkephalin

pdb file: 682224.pdb
sdf file: 682224.sdf
directory: 682224

(2S,3aR,7aS)-1-((S)-N-((S)-1-Carboxy-3-phenylpropyl)alanyl)hexahydro-2-indolinecarboxylic acid, 1-ethyl ester 1H-Indole-2-carboxylic acid, 1-((2S)-2-((1-(ethoxycarbonyl)-3-phenylpropyl)amino)-1-oxopropyl)octahydro-, (2S,3aR,7aS)- 1H-Indole-2-carboxylic acid, octahydro-1-(2-((1-(ethoxycarbonyl)-3-phenylpropyl)amino)-1-oxopropyl)-, (2S-(1(R*(R*)),2-alpha,3a-alpha,7a-beta))- 87679-37-6 CCRIS 6594 RU 44570 Trandolapril Trandolapril [BAN:INN] Trandolaprilum [Latin]

pdb file: 682319.pdb
sdf file: 682319.sdf
directory: 682319

(2S)-2-Amino-4-(methylsulfonyl)butanoyl-L-alpha-glutamyl-L-histidyl-L-phenylalanyl-D-lysyl-L-phenylalanine 50913-82-1 EINECS 256-843-1 L-Phenylalanine, (2S)-2-amino-4-(methylsulfonyl)butanoyl-L-alpha-glutamyl-L-histidyl-L-phenylalanyl-D-lysyl- L-Phenylalanine, gamma-(methylsulfonyl)-L-alpha-aminobutyryl-L-alpha-glutamyl-L-histidyl-L-phenylalanyl-D-lysyl- Org 2766 gamma-(Methylsulphonyl)-L-alpha-aminobutyryl-L-alpha-glutamyl-L-histidyl-3-phenyl-L-alanyl-D-lysyl-L-alanine

pdb file: 682462.pdb
sdf file: 682462.sdf
directory: 682462

(beta-Mercapto-beta,beta-cyclopentamethylene-propionyl(sup 1),O-Me-Tyr(sup 2),Arg(sup 8))-vasopressin (d(CH2)5(1)-O-Me-Tyr(2)-arg(8))vasopressin 1-(beta-Mercapto-beta,beta-cyclopentamethylenepropionic acid)-2-(O-methyl-tyr)-argipressin 1-(beta-Mercapto-beta,beta-cyclopentamethylenepropionic acid)-2-O-methyltyrosyl-8-arginine vasopressin 73168-24-8 AAVP AVPA Arginine vasopressin, beta-mercapto-(beta,beta-cyclopentamethylenepropionic acid)(1)-methyl-tyr(2)- Argipressin, (beta-mercapto)beta,beta-cyclopentamethylenepropionic acid(1)-O-methyl-tyr(2)- Cgp 25838 Cpg 25838E Glycinamide, N-((1-mercaptocyclohexyl)acetyl)-O-methyl-L-tyrosyl-L-phenylalanyl-L-glutaminyl-L-asparaginyl-L-cysteinyl-L-prolyl-L-arginyl-, cyclic (1-5)-disulfide Manning compound Mcppa-avp SK&F 100273 SKF 100273 Vasopressin, 1-(1-mercaptocyclohexaneacetic acid)-2-(O-methyl-L-tyrosine)-8-L-arginine- d(CH2)5(Tyr(Me)(2))AVP d(CH2)5-Tyr(Me)argipressin d(CH2)5Tyr(Me)AVP

pdb file: 682561.pdb
sdf file: 682561.sdf
directory: 682561

2,5-Piperazinedione, 3-methyl-, (S)- 4526-77-6 Cyclo(ala-gly) Cyclo(alanyl-glycyl) Cyclo(alanylglycyl)

pdb file: 684519.pdb
sdf file: 684519.sdf
directory: 684519

3617-46-7 EINECS 222-804-2 N-(N-((Phenylmethoxy)carbonyl)-L-phenylalanyl)-L-glutamic acid

pdb file: 684658.pdb
sdf file: 684658.sdf
directory: 684658

1-6-beta-Neoendorphin (human), 2-D-alanine- 2-D-Alanine-1-6-beta-neoendorphin (human) 81733-79-1 BRN 4287455 Dalargin Enkephalin-leu, ala(2)-arg(6)- L-Arginine, N(sup 2)-(N-(N-(N-(L-tyrosyl-D-alanyl)glycyl)-L-phenylalanyl)-L-leucyl)- N(sup 2)-(N-(N-(N-(L-Tyrosyl-D-alanyl)glycyl)-L-phenylalanyl)-L-leucyl)-L-arginine Tyrosyl-D-alanyl-glycyl-phenylalanyl-leucyl-arginine

pdb file: 684916.pdb
sdf file: 684916.sdf
directory: 684916

(N(alpha)-(3-Aminopropionyl)histidinato(2-)N1,N2,O(alpha))-zinc 107667-60-7 120520-26-5 132613-07-1 CCRIS 3974 Polaprezinc Polaprezinc [INN] Promac Promac (antiulcer agent) Z 103 Zinc L-carnosine Zinc, (N-beta-alanyl-L-histidinato(2-)-N,N(N),N3,O(alpha))-, (T-4)- Zinc, (N-beta-alanyl-L-histidinato(2-)-N,N(sup N),O(sup alpha))- Zinc, (beta-alanyl-kappaN-L-histidinato(2-)-kappaN,kappaO)- catena-Poly(zinc-mu-(beta-alanyl-L-histidinato(2(-))-N,N(sup N),O:N(sup tau)))

pdb file: 684930.pdb
sdf file: 684930.sdf
directory: 684930

89352-67-0 Ici 174864 Ici-174864 L-Leucine, N,N-di-2-propenyl-L-tyrosyl-2-methylalanyl-L-phenylalanyl- L-Leucine, N-(N-(N-(N,N-di-2-propenyl-L-tyrosyl)-2-methylalanyl)-L-phenylalanyl)- N,N-Diallyl-tyr-aib-phe-leu N,N-Diallyl-tyrosyl-alpha-aminoisobutyric acid-phenylalanyl-leucine

pdb file: 684940.pdb
sdf file: 684940.sdf
directory: 684940

1-Arg-7,9-trp-11-leu-substance P 91224-37-2 L-Leucinamide, D-arginyl-L-prolyl-L-lysyl-L-prolyl-L-glutaminyl-L-glutaminyl-D-tryptophyl-L-phenylalanyl-D-tryptophyl-L-leucyl- Spantide Spantide I Substance P, 1-D-arginine-7-D-tryptophan-9-D-tryptophan-11-D-leucine- Substance P, arg(1)-trp(7,9)-leu(11)- Substance P, arginyl(1)-tryptophyl(7,9)-leucine(11)-

pdb file: 684949.pdb
sdf file: 684949.sdf
directory: 684949

118992-92-0 Bim 23014 Bim-23014 L-Threoninamide, 3-(2-naphthalenyl)-D-alanyl-L-cysteinyl-L-tyrosyl-D-tryptophyl-L-lysyl-L-valyl-L-cysteinyl-, cyclic (2-7)-disulfide Lanreotide Nal-cyclo(cys-tyr-trp-lys-val-cys)-thr-NH2 Somatulin

pdb file: 684951.pdb
sdf file: 684951.sdf
directory: 684951

77614-16-5 Dermorphin H-Tyr-D-ala-phe-gly-tyr-pro-ser-NH2 Tyrosyl-alanyl-phenylalanyl-glycyl-tyrosyl-prolyl-serinamide

pdb file: 685044.pdb
sdf file: 685044.sdf
directory: 685044

83996-50-3 CCRIS 1548 L-Methionine, N-(3-(bis(2-chloroethyl)amino)-N-(4-fluoro-L-phenylalanyl)-L-phenylalanyl)-, ethyl ester, monohydrochloride PT 119 Ptt 119 Ptt-119

pdb file: 685047.pdb
sdf file: 685047.sdf
directory: 685047

33414-33-4 BRN 4827533 Carbamic acid, (10-(3-(diethylamino)-1-oxopropyl)-10H-phenothiazin-2-yl)-, ethyl ester EZ 55 Etacizin Ethacizine Ethacyzin Ethmozine DAA Ethyl (10-(3-(diethylamino)-1-oxopropyl)-10H-phenothiazin-2-yl)carbamate Etmozine DAA Phenothiazine-2-carbamic acid, 10-(N,N-diethyl-beta-alanyl)-, ethyl ester (8CI)

pdb file: 685126.pdb
sdf file: 685126.sdf
directory: 685126

62249-77-8 BRN 4624727 L-Lysine, N(sup 6)-(aminoiminomethyl)-N(sup 2)-(N-(N(sup 5)-(aminosulfoamino)phosphinyl)-L-ornithyl)-L-alanyl)- L-Lysine,N5-(amino(sulfoamino)phosphinyl)-L-alanyl-N6-(aminoiminomethyl)- Phaseolotoxin A

pdb file: 685130.pdb
sdf file: 685130.sdf
directory: 685130

2-Ser-thr-leu-enkephalin 75644-90-5 DSLET DSTLE Dislet Enkephalin-leu, ser(2)-thr- Enkephalin-leu, seryl(2)-threonine- L-Threonine, L-tyrosyl-D-serylglycyl-L-phenylalanyl-L-leucyl- L-Threonine, N-(N-(N-(N-(N-L-tyrosyl-D-seryl)glycyl)-L-phenylalanyl)-L-leucyl)- Leu-enkephalin, ser(2)-thr- Leucine-enkephalin, ser(2)-thr- Ser(2)-leu(5)-enkephalin-thr(6) Tyr-ser-gly-phe-leu-thr Tyrosyl-seryl-glycyl-phenylalanyl-leucyl-threonine

pdb file: 685132.pdb
sdf file: 685132.sdf
directory: 685132

83209-65-8 Cyclic(L-alanyl-D-alanyl-eta-oxo-L-alpha-aminooxiraneoctanoyl-D-prolyl) Cyclo(2-amino-8-oxo-9,10-epoxydecanoic acid-prolyl-alanyl-alanine) Cyclo(L-alanyl-D-alanyl-(alphaS,2S)-alpha-amino-eta-oxooxiraneoctanoyl-D-prolyl) Cyclo(aoe-pro-ala-ala) HC Toxin HC-Toxin

pdb file: 685152.pdb
sdf file: 685152.sdf
directory: 685152

142569-99-1 Endothelin-1 (8-21), succinyl-(glu(9),ala(11,15))- Irl 1620 Irl-1620 L-Tryptophan, N-(3-carboxy-1-oxopropyl)-L-alanyl-L-alpha-glutamyl-L-alpha-glutamyl-L-alanyl-L-valyl-L-tyrosyl-L-tyrosyl-L-alanyl-L-histidyl-L-leucyl-L-alpha-aspartyl-L-isoleucyl-L-isoleucyl- Succinyl-(glu(9),ala(11,15))-endothelin-1 (8-21) Succinyl-(glutamyl(9)-alanyl(11,15))-endothelin-1 (8-21)

pdb file: 685197.pdb
sdf file: 685197.sdf
directory: 685197

83539-08-6 Ac-D-pClPhe-D-pClPhe-D-Trp-Ser-Tyr-D-Arg-Leu-Arg-Pro-D-Ala-NH2-CH3-COOH D-Alanine, N-(1-(N(sup 2)-(N-(N(sup 2)-(N-(N-(N-(N-(N-acetyl-4-chloro-D-phenylalanyl)-4-chloro-D-phenylalanyl)-D-tryptophyl)-L-seryl)-L-tyrosyl)-D-arginyl)-L-leucyl)-L-arginyl)-L-prolyl)- D-Alanine, N-(1-(N2-(N-(N2-(N-(N-(N-(N-(N-acetyl-4-chloro-D-phenylalanyl)-4-chloro-D-phenylalanyl)-D-tryptophyl)-L-seryl)-L-tyrosyl)-D-arginyl)-L-leucyl)-L-arginyl)-L-prolyl)- D-Alanine, N-acetyl-4-chloro-D-phenylalanyl-4-chloro-D-phenylalanyl-D-tryptophyl-L-seryl-L-tyrosyl-D-arginyl-L-leucyl-L-arginyl-L-prolyl- Org 30276 Organon 30276

pdb file: 685264.pdb
sdf file: 685264.sdf
directory: 685264

2-Pro-7,9-trp-SP 2-Pro-7,9-trp-substance P 80434-86-2 DT 79 DT-79 L-Methioninamide, L-arginyl-D-prolyl-L-lysyl-L-prolyl-L-glutaminyl-L-glutaminyl-D-tryptophyl-L-phenylalanyl-D-tryptophyl-L-leucyl- PT-SP PTTSP Substance P, 2-D-proline-7-D-tryptophan-9-D-tryptophan- Substance P, pro(2)-trp(7,9)- Substance P, prolyl(2)-tryptophan(7,9)-

pdb file: 685418.pdb
sdf file: 685418.sdf
directory: 685418

137525-51-0 Booly protection compound 15 Bpc 15 Bpc 157 Bpc-157 L-Valine, glycyl-L-alpha-glutamyl-L-prolyl-L-prolyl-L-prolylglycyl-L-lysyl-L-prolyl-L-alanyl-L-alpha-aspartyl-L-alpha-aspartyl-L-alanylglycyl-L-leucyl-

pdb file: 685433.pdb
sdf file: 685433.sdf
directory: 685433

(S)-N-Acetyl-L-tyrosyl-L-valyl-N-(2-carboxy-1-formylethyl)-L-alaninamide 143313-51-3 207513-29-9 Ac-Tyr-val-ala-asp-cho Ac-Yvad-cho Acetyl-tyr-val-ala-asp-cho Acetyl-tyrosyl-valyl-alanyl-aspartinal L 709,049 L 709049 L-709,049 L-709049 L-Alaninamide, N-acetyl-L-tyrosyl-L-valyl-N-((1S)-2-carboxy-1-formylethyl)- L-Alaninamide, N-acetyl-L-tyrosyl-L-valyl-N-(2-carboxy-1-formylethyl)-, (S)- N-Acetyltyrosyl-valyl-alanyl-aspartyl aldehyde Ycad-CHO

pdb file: 685434.pdb
sdf file: 685434.sdf
directory: 685434

1-8-Dynorphin B (swine), 8-L-isoleucine- 75790-53-3 8-L-Isoleucine-1-8-dynorphin B (swine) Dynorphin (1-8) Dynorphin A (1-8) L-Isoleucine, N-(N(2)-(N(2)-(N-(N-(N-(N-L-tyrosylglycyl)glycyl)-L-phenylalanyl)-L-leucyl)-L-arginyl)-L-arginyl)- PH-8P Tyr-gly-gly-phe-leu-arg-arg-ile Tyrosyl-glycyl-glycyl-phenylalanyl-leucyl-arginyl-arginyl-isoleucine alpha-Neoendorphin, 7-L-arginine-8-L-isoleucine-9-de-L-proline-10-de-L-lysine-

pdb file: 685478.pdb
sdf file: 685478.sdf
directory: 685478

106128-89-6 4-10-Neuromedin B (swine spinal cord), N-(3-carboxy-1-oxopropyl)-6-(N-methyl-L-phenylalanine)-7-de-L-valine- L-Methioninamide, N-(3-carboxy-1-oxopropyl)-L-alpha-aspartyl-L-phenylalanyl-N-methyl-L-phenylalanylglycyl-L-leucyl- N-(3-Carboxy-1-oxopropyl)-6-(N-methyl-L-phenylalanine)-7-de-L-valine-4-10-neuromedin B (swine spinal cord) Senktide Substance P (6-11), succinyl-asp(6)-Me-phe(8)- Substance P (6-11), succinyl-aspartyl(6)-methylphenylalanine(8)- Succinyl-6-asp-8-Me-phe-substance P (6-11)

pdb file: 685494.pdb
sdf file: 685494.sdf
directory: 685494

(D-Pen2,D-Pen5)-Enkephalin 88373-73-3 D-Valine, L-tyrosyl-3-mercapto-D-valylglycyl-L-phenylalanyl-3-mercapto-, cyclic (2-5)-disulfide

pdb file: 685531.pdb
sdf file: 685531.sdf
directory: 685531

100929-53-1 L-Phenylalaninamide, L-tyrosyl-D-alanylglycyl-N-(2-hydroxyethyl)-Nalpha-methyl-, monoacetate (salt) L-Tyrosyl-D-alanylglycyl-N-(2-hydroxyethyl)-Nalpha-methyl-L-phenylalaninamide monoacetate (salt)

pdb file: 685575.pdb
sdf file: 685575.sdf
directory: 685575

112568-12-4 Antide BRN 4866881 D-Alaninamide, N-acetyl-3-(2-naphthalenyl)-D-alanyl-4-chloro-D-phenylalanyl-3-(3-pyridinyl)-D-alanyl-L-seryl-N(sup 6)-(3-pyridinylcarbonyl)-L-lysyl-N(sup 6)-(3-pyridinylcarbonyl)-D-lysyl-L-leucyl-N(sup 6)-(1-methylethyl)-L-lysyl-L-prolyl- D-Alaninamide, N-acetyl-3-(2-naphthalenyl)-D-alanyl-4-chloro-D-phenylalanyl-3-(3-pyridinyl)-D-alanyl-L-seryl-N6-(3-pyridinylcarbonyl)-L-lysyl-N6-(3-pyridinylcarbonyl)-D-lysyl-L-leucyl-N6-(1-methylethyl)-L-lysyl-L-prolyl- Orf 23541

pdb file: 685579.pdb
sdf file: 685579.sdf
directory: 685579

1-L-Alanyl-D-proline 60643-20-1 EINECS 262-343-4

pdb file: 686337.pdb
sdf file: 686337.sdf
directory: 686337

(2S-cis)-5-Benzyl-3,6-dioxopiperazine-2-acetic acid 3-Phenylmethyl-2,5-diketopiperazine-6-acetic acid 5262-10-2 CCRIS 5457 Cyclo(aspartyl-phenylalanyl) EINECS 226-075-1

pdb file: 688315.pdb
sdf file: 688315.sdf
directory: 688315

5874-90-8 Alanyl-alanyl-alanine EINECS 227-538-0 N-L-Alanyl-N-L-alanyl-L-alanine

pdb file: 688363.pdb
sdf file: 688363.sdf
directory: 688363

13122-91-3 3-Phenyl-N-(3-phenyl-N-((phenylmethoxy)carbonyl)-L-alanyl)-L-alanine EINECS 236-051-2

pdb file: 691520.pdb
sdf file: 691520.sdf
directory: 691520

13123-01-8 EINECS 236-054-9 N-(N-((Phenylmethoxy)carbonyl)-L-phenylalanyl)-L-isoleucine

pdb file: 691521.pdb
sdf file: 691521.sdf
directory: 691521

63478-55-7 Des-N-tetramethyltriostin A L-Valine, N-(2-quinoxalinylcarbonyl)-D-seryl-L-alanyl-L-cysteinyl-, bimol. (4-1'),(4'-1)-dilactone, cyclic (3-3')-disulfide L-Valine, N-(2-quinoxalinylcarbonyl)-D-seryl-L-alanyl-L-cysteinyl-, bimol. lactone, cyclic disulfide Tandem

pdb file: 691634.pdb
sdf file: 691634.sdf
directory: 691634

103429-31-8 CTOP CTOPA Ctop-NH2 Cys(2)-tyr(3)-orn(5)-pen(7)-amide L-Threoninamide, D-phenylalanyl-L-cysteinyl-L-tyrosyl-D-tryptophyl-L-ornithyl-L-threonyl-3-mercapto-L-valyl-, cyclic (2-7)-disulfide Phe-cycl(cys-tyr-trp-orn-thr-pen)thr-NH2 Phenylalanyl-cyclo(cysteinyltyrosyl-tryptophyl-ornithyl-threonyl-penicillamine)threoninamide

pdb file: 691658.pdb
sdf file: 691658.sdf
directory: 691658

1-(N-(N-Benzoyl-L-phenylalanyl)-L-alanyl)-L-proline 69677-91-4 BPAAP Benzoyl-phe-ala-pro Benzoylphenylalanyl-alanyl-proline L-Proline, 1-(N-(N-benzoyl-L-phenylalanyl)-L-alanyl)-

pdb file: 691919.pdb
sdf file: 691919.sdf
directory: 691919

73715-37-4 D-Alanine, N-(N-(N2-(N2-(N-(N-acetyl-4-O-(2-(acetylamino)-2-deoxy-beta-D-glucopyranosyl)muramoyl)-L-alanyl)-D-alpha-glutaminyl)-(R*,S*)-6-carboxylysyl)-D-alanyl)- D-Alanine, N-(N-acetyl-4-O-(2-(acetylamino)-2-deoxy-beta-D-glucopyranosyl)muramoyl)-L-alanyl-D-alpha-glutaminyl-meso-alpha,epsilon-diaminopimelyl-D-alanyl- N-Acetylglucosaminyl-N-acetylmuramyl-L-alanyl-D-isoglutaminyl-meso-diaminopimelic acid-D-alanyl-D-alanine N-Acetylglucosaminyl-N-acmu-ala-iso-gln-meso-diaminopimelic acid-ala-ala Peptidoglycan monomer

pdb file: 692038.pdb
sdf file: 692038.sdf
directory: 692038

(S)-L-Prolyl-N-(4-((aminoiminomethyl)amino)-1-(chloroacetyl)butyl)-L-phenylalaninamide 65149-23-7 D-Phe-pro-arg-chloromethyl ketone FPRCK Fprmecl L-Phenylalaninamide, L-prolyl-N-(4-((aminoiminomethyl)amino)-1-(chloroacetyl)butyl)-, (S)- PPACK Phe-pro-arg-CH2-Cl Phe-pro-arg-CK Phenylalanyl-prolyl-arginine-chloromethyl ketone Phenylalanyl-prolyl-arginyl-chloromethane

pdb file: 692159.pdb
sdf file: 692159.sdf
directory: 692159

125787-94-2 FK 224 FK-224 L-Serine, N-(1-oxo-3-(2-pentylphenyl)propyl)-L-threonyl-(alphaE)-alpha,beta-didehydro-N-methyltyrosyl-L-leucyl-D-phenylalanyl-L-allothreonyl-L-asparaginyl-, (7-1)-lactone L-Serine, N-(N2-(N-(N-(N-(alpha,beta-didehydro-N-methyl-N-(N-(1-oxo-3-(2-pentylphenyl)propyl)-L-threonyl)tyrosyl)-L-leucyl)-D-phenylalanyl)-L-allothreonyl)-L-asparaginyl)-, nu-lactone N-(N(2)-(N-(N-(N-(2,3-Didehydro-N-methyl-N-(N-(3-(2-pentylphenyl)-propionyl)-L-threonyl)tyrosyl-L-leucyl)-D-phenylalanyl)-L-allo-threonyl)-L-asparaginyl))-L-serine-epsilon-lactone

pdb file: 692209.pdb
sdf file: 692209.sdf
directory: 692209

76975-04-7 Ferric pseudobactin L-Alaninamide, N6-(((1S)-5-((4-amino-1,4-dioxobutyl)amino)-2,3-dihydro-8,9-dihydroxy-1H-pyrimido(1,2-a)quinolin-1-yl)carbonyl)-L-lysyl-(3R)-3-hydroxy-D-alpha-aspartyl-L-alanyl-D-allothreonyl-N-((3R)-1-hydroxy-2-oxo-3-piperidinyl)- L-Alaninamide, N6-((5-((4-amino-1,4-dioxobutyl)amino)-2,3-dihydro-8,9-dihydroxy-1H-pyrimido(1,2-a)quinolin-1-yl)carbonyl)-L-lysyl-threo-3-hydroxy-D-alpha-aspartyl-L-alanyl-D-allothreonyl-N-(1-hydroxy-2-oxo-3-piperidinyl)-, (1(S),5(R))- Pseudobactin

pdb file: 692320.pdb
sdf file: 692320.sdf
directory: 692320

3-N-Me-Phe-morphiceptin 83397-56-2 D-Prolinamide, L-tyrosyl-L-prolyl-N-methyl-L-phenylalanyl- L-Tyrosyl-L-prolyl-N-methyl-L-phenylalanyl-D-prolinamide Morphiceptin, N-Me-phe(3)- Morphiceptin, N-methylphenylalanine(3)- PL 017 PL 17 PLO17 Tyr-pro-N-mephe-pro-NH2 Tyrosyl-prolyl-N-methylphenlalanyl-prolinamide

pdb file: 692327.pdb
sdf file: 692327.sdf
directory: 692327

83420-94-4 Glycinamide, N,N-di-2-propenyl-L-tyrosyl-N-(2-((2-((1-carboxy-3-methylbutyl)amino)-2-oxo-1-(phenylmethyl)ethyl)thio)ethyl)-, (S-(R*,R*))- ICI 154129 ICI-154129 L-Leucine, N,N-di-2-propenyl-L-tyrosylglycyl-(alphaS)-alpha-((2-aminoethyl)thio)benzenepropanoyl- M 154,129 M-154,129 N,N-Bis(allyl)-tyr-gly-gly-psi-methylthio-phe-leu N,N-Bis(allyl)-tyrosyl-glycyl-glycyl-psi-methylthio-phenylalanyl-leucine N,N-Di-2-propenyl-L-tyrosylglycyl-(alphaS)-alpha-((2-aminoethyl)thio)benzenepropanoyl-L-leucine

pdb file: 692328.pdb
sdf file: 692328.sdf
directory: 692328

87096-84-2 Gly-asn-leu-trp-ala-thr-gly-his-phe-met-NH2 Glycyl-arginyl-leucyl-tryptophyl-alanyl-threonyl-glycyl-histidyl-phenylalanyl-methioninamide Neuromedin B Neuromedin B (swine spinal cord) Ranatensin, 1-glycine-2-L-asparagine-3-L-leucine-4-de-L-glutamine-7-L-threonine-

pdb file: 692333.pdb
sdf file: 692333.sdf
directory: 692333

119975-64-3 Deltorphin Deltorphin A Dermenkephalin L-alpha-Asparagine, N2-(N-(N-(N-(N-(N-L-tyrosyl-D-methionyl)-L-phenylalanyl)-L-histidyl)-L-leucyl)-L-methionyl)- Tyr-met-phe-his-leu-met-asp-NH2 Tyrosyl-methionyl-phenylalanyl-histidyl-leucyl-methionyl-aspartamide

pdb file: 692362.pdb
sdf file: 692362.sdf
directory: 692362

71048-99-2 Bialaphos sodium Bilanafos-sodium L-Alanine, gamma-(hydroxymethylphosphinyl)-L-alpha-aminobutyryl-L-alanyl-, monosodium salt MW 801 Meiji herbiace SF 1293 Sodium L-2-amino-4-((hydroxy)(methyl)phosphinoyl)butyryl-L-alanyl-L-alanine gamma-(Hydroxymethylphosphinyl)-L-alpha-aminobutyryl-L-alanyl-L-alanine sodium salt

pdb file: 693396.pdb
sdf file: 693396.sdf
directory: 693396

32976-86-6 EINECS 251-317-8 Ethyl N-(3-(bis(2-chloroethyl)amino)-N-(N-(4-fluoro-3-phenyl-L-alanyl)glycyl)-3-phenyl-L-alanyl)-L-norvalinate

pdb file: 694723.pdb
sdf file: 694723.sdf
directory: 694723

(Dtpa-phe(1))-octreotide (In111-Dtpa-phe(1))-octreotide 142694-57-3 161Tb-(Dtpa-phe(1))-octreotide Indium-111-D-phe(1)-octreotide L-Threonine, N-(2-((2-(bis(carboxymethyl)amino)ethyl)(carboxymethyl)amino)ethyl)-N-(carboxymethyl)glycyl-D-phenylalanyl-L-cysteinyl-L-phenylalanyl-D-tryprophyl-L-lysyl-L-threonyl-L-cysteinyl-, cyclic (3-8)-disulfide Octreoscan 111 Octreotide, dtpa-phe(1)- Pentatreotide Sdz 215-811 Sdz-215-811 Terbium-161-(dtpa-phe(1))-octreotide

pdb file: 695677.pdb
sdf file: 695677.sdf
directory: 695677

66960-34-7 L-Methioninamide, L-tyrosyl-D-alanylglycyl-L-phenylalanyl-N2-methyl- L-Tyrosyl-D-alanylglycyl-L-phenylalanyl-N2-methyl-L-methioninamide Metkefamida [INN-Spanish] Metkefamidum [INN-Latin] Metkephamid Metkephamide

pdb file: 695787.pdb
sdf file: 695787.sdf
directory: 695787

5-Oxo-L-prolyl-L-phenylalanyl-L-phenylalanyl-L-prolyl-L-leucyl-L-methioninamide 6-Glp-9-pro-substance P (6-11) 79775-19-2 Glp-phe-phe-pro-leu-met-NH2 L-Methioninamide, 5-oxo-L-prolyl-L-phenylalanyl-L-phenylalanyl-L-prolyl-L-leucyl- Pglu(6)-pro(9)-SP(6-11) Pglu-phe-phe-pro-leu-met-NH2 Septide Substance P (6-11), glp(6)-pro(9)- Substance P (6-11), pyroglutamyl(6)-proline(9)-

pdb file: 695803.pdb
sdf file: 695803.sdf
directory: 695803

53193-10-5 55070-01-4 AM Toxin I AM-Toxin I Cyclo(2,3-didehydroalanyl-L-alanyl-(2S)-2-hydroxy-3-methylbutanoyl-5-(4-methoxyphenyl)-L-norvalyl)

pdb file: 695951.pdb
sdf file: 695951.sdf
directory: 695951

74135-04-9 Deproceptin L-Prolinamide, L-tyrosyl-L-prolyl-L-phenylalanyl- L-Tyrosyl-L-prolyl-L-phenylalanyl-L-prolinamide Morphiceptin NH(4)-Tyr-pro-phe-pro-conh(2) Tyr-pro-phe-D-pro-NH2 Tyr-pro-phe-pro amide Tyrosyl-prolyl-phenylalanyl-D-prolinamide beta-Casomorphine(1-4) amide

pdb file: 695979.pdb
sdf file: 695979.sdf
directory: 695979

2-Threonyl-6-threonyl-5-leucine enkephalin 85286-38-0 DTLET Deltakephalin Enkephalin leu, thr(2)-thr(6)- L-Threonine, N-(N-(N-(N-(N-L-tyrosyl-D-threonyl)glycyl)-L-phenylalanyl)-L-leucyl)- Leu-enkephalin, thr(2)-thr(6)- Leucine enkephalin, 2-threonyl-6-threonyl- N-(N-(N-(N-(N-L-Tyrosyl-D-threonyl)glycyl)-L-phenylalanyl)-L-leucyl)-L-threonine Thr(2)-leu(5)-enkephalyl-thr(6) Tyr-D-thr-gly-phe-leu-thr Tyrosyl-threonyl-glycyl-phenylalanyl-leucyl-threonine

pdb file: 695996.pdb
sdf file: 695996.sdf
directory: 695996

(S)-8-Methyl-6,9-diazaspiro(4.5)decane-7,10-dione 6'(S)-Methyl-2',5'-dioxospiro(cyclopentane-1,3'-piperazine) 6,9-Diazaspiro(4.5)decane-7,10-dione, 8-methyl-, (S)- 90058-29-0 Alaptide BRN 5936003 Cyclo (Acp-L-Ala) Cyclo(1-amino-1-cyclopentanecarbonyl-L-alanyl) Cyclo(alanine-(1-amino-1-cyclopentane)carbonyl) VUFB-15754

pdb file: 696005.pdb
sdf file: 696005.sdf
directory: 696005

113294-82-9 3-(2-Naphthalenyl)-D-alanyl-L-cysteinyl-L-tyrosyl-D-tryptophyl-L-lysyl-L-valyl-L-cysteinyl-L-threoninamide 3-(2-Naphthyl)-D-ala-cys-tyr-D-trp-lys-val-cys-thr-NH2 3-(2-Naphthyl)alanyl-cystinyl-tyrosyl-tryptophyl-lysyl-valyl-cystinyl-threonine amide Angiopeptin Bim 23014 C D-Nal-cys-tyr-trp-lys-val-cys-thr-NH2 L-Threoninamide, 3-(2-naphthalenyl)-D-alanyl-L-cysteinyl-L-tyrosyl-D-tryptophyl-L-lysyl-L-valyl-L-cysteinyl-

pdb file: 696030.pdb
sdf file: 696030.sdf
directory: 696030

64374-58-9 Ac-Mur-L-ala-gamma-D-gln-meso-A(2)pm Acmu-ala-iso-gln-2,2'-diaminopimelic acid D-Glutamine, N2-(N-(N-acetylmuramoyl)-L-alanyl)-N-(5-amino-1,5-dicarboxypentyl)-, (R*,S*)- DL-Lysine, N2-(N2-(N-(N-acetylmuramoyl)-L-alanyl)-D-alpha-glutaminyl)-6-carboxy-, erythro- Lysine, N-(N-acetylmuramoyl)-L-alanyl-D-alpha-glutaminyl-6-carboxy-, erythro- Muramyl tripeptide Murnac-tripeptide N-(N-Acetylmuramoyl)-L-alanyl-D-alpha-glutaminyl-6-carboxylysine, N-Acetylmuramyl-alanyl-isoglutaminyl-meso-2,2'-diaminopimelic acid

pdb file: 696207.pdb
sdf file: 696207.sdf
directory: 696207

133156-06-6 GR 73632 GR-73632 L-Methioninamide, N-(5-amino-1-oxopentyl)-L-phenylalanyl-L-phenylalanyl-L-prolyl-N-methyl-L-leucyl- N-(5-Amino-1-oxopentyl)-L-phenylalanyl-L-phenylalanyl-L-prolyl-N-methyl-L-leucyl-L-methioninamide Substance P (7-10), delta-aminovaleryl-pro(9)-N-meleu(10)- Substance P (7-10),delta-aminovaleryl-prolyl(9)-N-methylleucine(10)- delta-Aminovaleryl-9-pro-10-meleu-substance P (7-10)

pdb file: 696298.pdb
sdf file: 696298.sdf
directory: 696298

28782-78-7 EINECS 249-219-5 N-(N-((1,1-Dimethylethoxy)carbonyl)-L-alanyl)glycine

pdb file: 696757.pdb
sdf file: 696757.sdf
directory: 696757

3-Amino-N-(2-mercaptoethyl)propionamide 4-04-00-02529 (Beilstein Handbook Reference) 539-83-3 Aletheine BRN 1703070 Propanamide, 3-amino-N-(2-mercaptoethyl)- (9CI) Propionamide, 3-amino-N-(2-mercaptoethyl)- beta-Alanylaminoethanethiol

pdb file: 697394.pdb
sdf file: 697394.sdf
directory: 697394

121912-19-4 Achatin-I Achatin-II Gfad peptide Gly-delta(Z)-phe(2)-ala-asp Gly-phe-ala-asp Glycyl-phenylalanyl-alanyl-aspartic acid L-Aspartic acid, N-(N-(N-glycyl-D-phenylalanyl)-L-alanyl)- achatin I

pdb file: 698341.pdb
sdf file: 698341.sdf
directory: 698341

97590-38-0 D-alpha-Glutamine, N2-(N-(N-acetyl-O-(2-amino-2-deoxy-beta-D-glucopyranosyl)muramoyl)-L-alanyl)- GMDP GMPD Glucosaminyl-mdp Glucosaminyl-muramyl-dipeptide glucosaminylmuramyl dipeptide

pdb file: 698342.pdb
sdf file: 698342.sdf
directory: 698342

115406-23-0 N-(N-(1-Carboxyl-3-phenylpropyl)-phe)-iso-ser N-(N-(1-Carboxyl-3-phenylpropyl)phenylalanyl)isoserine Sch 39370 Sch-39370 beta-Alanine, N-(N-(1-carboxy-3-phenylpropyl)-L-phenylalanyl)-2-hydroxy-, (S-(R*,R*))-

pdb file: 698375.pdb
sdf file: 698375.sdf
directory: 698375

133155-89-2 Cyclo((S)-gamma-oxo-L-alpha-aminooxiraneoctanoyl-L-phenylalanyl-L-phenylalanyl-D-2-piperidinecarbonyl) Cyclo((S)-phenylalanyl-(S)-phenylalanyl-(R)-pipecolinyl-(2S,9S)-2-amino-8-oxo-9,10-epoxydecanoyl) Trapoxin trapoxin A

pdb file: 698378.pdb
sdf file: 698378.sdf
directory: 698378

2-furanacryloyl-phenylalanyl-glycyl-glycine 3-(2-Furylacryloyl)phenylalanyl-glycyl-glycine 64967-39-1 FA-Phe-gly-gly FAPGG Glycine, N-(N-(N-(3-(2-furanyl)-1-oxo-2-propenyl)-L-phenylalanyl)glycyl)-

pdb file: 698408.pdb
sdf file: 698408.sdf
directory: 698408

81213-55-0 L-Lysine, N6-(N-(N-(N-formyl-L-methionyl)-L-leucyl)-L-phenylalanyl)- N-formylmethionyl-leucyl-phenylalanyl-lysine f-Met-leu-phe-lys fMLPL

pdb file: 698413.pdb
sdf file: 698413.sdf
directory: 698413

80690-77-3 Flrfamide L-Phenylalaninamide, L-phenylalanyl-L-leucyl-L-arginyl- phenylalanyl-leucyl-arginyl phenylalaninamide

pdb file: 698419.pdb
sdf file: 698419.sdf
directory: 698419

65144-34-5 L-Prolinamide, N-(4-methoxy-1,4-dioxobutyl)-L-alanyl-L-alanyl-N-(3-chloro-1-(1-methylethyl)-2-oxopropyl)-, (S)- Meosuc-aapv-cmk Methoxy-suc-ala-ala-pro-val-chloromethyl ketone Msaapvck methoxysuccinyl-alanyl-alanyl-prolyl-valine chloromethyl ketone

pdb file: 698445.pdb
sdf file: 698445.sdf
directory: 698445

72122-62-4 L-Isoleucine, N-(1-(N-(1-(N-(1-L-tyrosyl-L-prolyl)-L-phenylalanyl)-L-prolyl)glycyl)-L-prolyl)- Tyr-pro-phe-pro-gly-pro-ile Tyrosyl-prolyl-phenylalanyl-prolylglycyl-prolyl-isoleucine beta-casomorphin 7

pdb file: 698454.pdb
sdf file: 698454.sdf
directory: 698454

6-Arg-leu-enkephalin 75106-70-6 Enkephalin-leu, arginine(6)- L-Arginine, N(2)-(N-(N-(N-(N-L-tyrosylglycyl)glycyl)-L-phenylalanyl)-L-leucyl)- Leu-enkephalin, arg(6)- Leucine-enkephalin, arg(6)- alpha-Neoendorphin (pig), 7-de-L-lysine-8-de-L-tyrosine-9-de-L-proline-10-de-L-lysine- alpha-Neoendorphin, 7-de-L-lysine-8-de-L-tyrosine-9-de-L-proline-10-de-L-lysine- enkephalin-Leu, Arg(6)-

pdb file: 698503.pdb
sdf file: 698503.sdf
directory: 698503

76490-22-7 D-Lactyl-L-alanyl-alpha-glutamyl-(L)-meso-diaminopimelyl-(L)-glycine FK 156 FK-156 Glycine, N-(2-hydroxy-1-oxopropyl)-L-alanyl-D-gamma-glutamyl-L-erythro-alpha,epsilon-diaminopimelyl-, (R)- Glycine, N-(2-hydroxy-1-oxopropyl)-L-alanyl-D-gamma-glutamyl-meso-alpha,epsilon-diaminopimelyl-, (R)-

pdb file: 698505.pdb
sdf file: 698505.sdf
directory: 698505

96922-64-4 Benzyloxycarbonyl-phe-ala-fluormethylketone Benzyloxycarbonylphenylalanyl-alanine fluoromethyl ketone Carbamic acid, (2-((3-fluoro-1-methyl-2-oxopropyl)amino)-2-oxo-1-(phenylmethyl)ethyl)-, phenylmethyl ester Carbobenzoxy-L-phenylalanyl-(D,L)-alanyl fluoromethyl ketone MDL 201053 Mdl 201117 Mdl-201053 Z-Phe-ala-CH2F Z-Phe-ala-fmk Zfa-fmk

pdb file: 698523.pdb
sdf file: 698523.sdf
directory: 698523

146369-65-5 L-Phenylalanine, L-tyrosyl-L-1,2,3,4-tetrahydro-3-isoquinolinecarbonyl-L-phenylalanyl- L-Tyrosyl-L-1,2,3,4-tetrahydro-3-isoquinolinecarbonyl-L-phenylalanyl-L-phenylalanine TIPP Tyr-tic-phe-phe-OH tyrosyl-1,2,3,4-tetrahydro-3-isoquinolinecarbonyl-phenylalanyl-phenylalanine

pdb file: 698536.pdb
sdf file: 698536.sdf
directory: 698536

7-CPP 84211-54-1 Antagonist srif-A CPP1 CyCam Cyclo(7-ahep-phe-trp-lys-thr(bzl)) Cyclo(7-aminoheptanoylphenylalanyl-tryptophyl-lysyl-benzylthreonyl) Cyclo-(7-ahep-phe-trp-lys-bzl-thr)-somatostatin Cyclo-(7-aminoheptanoyl-phe-D-trp-lys-thr(bzl)) Cyclo-(7-aminoheptanoyl-phenylalanyl-tryptophyl-lysyl-benzylthreonyl)-somatostatin L-Threonine, N-(7-amino-1-oxoheptyl)-L-phenylalanyl-D-tryptophyl-L-lysyl-O-(phenylmethyl)-, (2S-(1(R*(R*)),2alpha,3abeta,7abeta))- Somatostatin, cyclo-(7-aminoheptanoyl-phenylalanyl-tryptophyl-lysyl-benzylthreonyl)- somatostatin, cyclo-(7-Ahep-Phe-Trp-Lys-Bzl-Thr)-

pdb file: 698595.pdb
sdf file: 698595.sdf
directory: 698595

(S-(R*,R*))-N-(N-(4-Hydroxy-1-oxo-6-phenyl-5-((N-(N-((phenylmethoxy)carbonyl)-L-alanyl)-L-alanyl)amino)hexyl)-L-valyl)-L-valine methyl ester 126380-03-8 Benzyloxycarbonyl-alanyl-alanyl-phenylalanyl-psi(CHOHCH2)-glycyl-valyl-valine methyl ester Cbz-aaphepsi((s)-CH(OH)CH2)glyvv-ome Cbz-ala-ala-phe-psi(CHOHCH2)-gly-val-val-ome L-Valine, N-(N-(4-hydroxy-1-oxo-6-phenyl-5-((N-(N-((phenylmethoxy)carbonyl)-L-alanyl)-L-alanyl)amino)hexyl)-L-valyl)-, methyl ester, (S-(R*,R*))- SK&F 107461 SK&F-107461 SKF 107461

pdb file: 698613.pdb
sdf file: 698613.sdf
directory: 698613

129987-97-9 Cpf ester L-Phenylalanine, N-(1-(methoxyoxoacetyl)-L-prolyl)-, phenylmethyl ester N-Carbomethoxycarbonyl-pro-phe-benzyl ester N-Carbomethoxycarbonyl-prolyl-phenylalanyl-benzyl ester

pdb file: 698621.pdb
sdf file: 698621.sdf
directory: 698621

138147-78-1 CCRIS 6547 L-Histidinamide, N2-((2,3,4,9-tetrahydro-1H-pyrido(3,4-b)indol-3-yl)carbonyl)-L-glutaminyl-L-tryptophyl-L-alanyl-L-valylglycyl-N-(1-(((1-(aminocarbonyl)-3-methylbutyl)amino)methyl)-3-methylbutyl)-, (1(S),6(S-(R*,R*)))- RC 3095 Rc-3095 bombesin (6-14), Tpi(6)-Leu(13)-psi(CH2NH)-Leu(14)-

pdb file: 698646.pdb
sdf file: 698646.sdf
directory: 698646

143037-36-9 Ac-Dip-leu-asp-ile-ile-trp Acetyldiphenylalanyl-leucyl-aspartyl-isoleucyl-isoleucyl-tryptophan L-Tryptophan, N-(N-(N-(N-(N-(N-acetyl-3-(1,1'-biphenyl)-4-yl-D-alanyl)-L-leucyl)-L-alpha-aspartyl)-L-isoleucyl)-L-isoleucyl)- N-(N-(N-(N-(N-(N-Acetyl-3-(1,1'-biphenyl)-4-yl-D-alanyl)-L-leucyl)-L-alpha-aspartyl)-L-isoleucyl)-L-isoleucyl)-L-tryptophan PD 142893 PD-142893

pdb file: 698668.pdb
sdf file: 698668.sdf
directory: 698668

157351-81-0 Cyclo(met-asp-trp-phe-dap-leu)cyclo(2beta-5beta) Cyclo(methionyl-aspartyl-tryptophyl-phenylalanyl-diaminopropanoyl-leucyl)cyclo(2beta-5beta) MEN 10627 Men 10,627

pdb file: 698670.pdb
sdf file: 698670.sdf
directory: 698670

121822-23-9 63-O-Sulfo-tyr-hirudin (53-64) Asparaginyl-glycyl-aspartyl-phenylalanyl-glutamyl-glutamyl-isoleucyl-prolyl-glutamyl-glutamyl-O-sulfotyrosyl-leucine BG 8865 Hirudin (53-64), O-sulfo-tyr(63)- Hirudin (53-64), O-sulfotyrosine(63)- Hirudin dodecapeptide L-Leucine, N-(N-(N-(N-(1-(N-(N-(N-(N-(N-(N-L-asparaginylglycyl)-L-alpha-aspartyl)-L-phenylalanyl)-L-alpha-glutamyl)-L-alpha-glutamyl)-L-isoleucyl)-L-prolyl)-L-alpha-glutamyl)-L-alpha-glutamyl)-O-sulfo-L-tyrosyl)- NH2-Asn-gly-asp-phe-glu-glu-ile-pro-glu-glu-(SO3)tyr-leu-cooh hirugen

pdb file: 698675.pdb
sdf file: 698675.sdf
directory: 698675

80714-61-0 ACTH (4-7), Pro-Gly-Pro- ACTH (4-7), prolyl-glycyl-proline- L-Proline, 1-(N-(1-(N-(N-(N-L-methionyl-L-alpha-glutamyl)-L-histidyl)-L-phenylalanyl)-L-prolyl)glycyl)- Pro-gly-pro-acth (4-7) Semax

pdb file: 698701.pdb
sdf file: 698701.sdf
directory: 698701

110881-59-9 2-Ala-6-cys-leu-enkephalin DALCE Enkephalin-leu, alanyl(2)-cysteine(6)- L-Cysteine, N-(N-(N-(N-(N-L-tyrosyl-D-alanyl)glycyl)-L-phenylalanyl)-L-leucyl)- Leu-enkephalin, ala(2)-cys(6)- Leucine-enkephalin, ala(2)-cys(6)- enkephalin-Leu, Ala(2)-Cys(6)-

pdb file: 698705.pdb
sdf file: 698705.sdf
directory: 698705

105262-04-2 N-(N-(1-(((2,2-Dimethyl-1,3-dioxolan-4-yl) methoxy)carbonyl)-2-phenylethyl)phenylalanine)alanine Sch 34826 Sch-34826 beta-Alanine, N-(N-(2-((2,2-dimethyl-1,3-dioxolan-4-yl)methoxy)-2-oxo-1-(phenylmethyl)ethyl)-L-phenylalanyl)-

pdb file: 698706.pdb
sdf file: 698706.sdf
directory: 698706

1-Des-ala-2-desamino-gly-3-cys-11-tyr-3,14-dicarbasomatostatin 3,14-Dicarbasomatostatin, 1-de-L-alanine-2-deglycine-3-butanoic acid-11-L-tyrosine- 86170-12-9 CGP 23996 Cgp-23996 Somatostatin, des-ala(1)-desamino-gly(2)-cys(3)-tyr(11)-dicarba(3,14)- Somatostatin, desalanyl(1)-desaminoglycyl(2)-cysteinyl(3)-tyrosyl(11)-dicarba(3,14)-

pdb file: 698737.pdb
sdf file: 698737.sdf
directory: 698737

1-N-Me-Tyr(1)-7-N-Me-arg-8-N-Et-leunh2-dynorphin (1-8) 103613-84-9 D-Leucinamide, N-methyl-L-tyrosylglycylglycyl-L-phenylalanyl-L-leucyl-L-arginyl-N2-methyl-L-arginyl-N-ethyl- Dynorphin (1-8), N-Me-tyr(1)-N-Me-arg(7)-N-Et-leunh2(8)- Dynorphin (1-8), N-methyltyrosyl(1)-N-methylarginyl(7)-N-ethylleucinamide(8)- E 2078 E-2078 N-Me-Tyr-gly-gly-phe-leu-arg-N-Me-arg-leu-NH-C2H5 N-Methyltyrosyl-glycyl-glycyl-phenylalanyl-leucyl-arginyl-N-methyl-arginyl-leucyl ethylamide

pdb file: 698742.pdb
sdf file: 698742.sdf
directory: 698742

(N-(1-Carboxy-2-phenyl)ethyl)phenylalanyl-B-alanine 83861-02-3 SCH 32615 Sch-32615 beta-Alanine, N-(N-(1-carboxy-2-phenylethyl)-L-phenylalanyl)-, (S)-

pdb file: 698743.pdb
sdf file: 698743.sdf
directory: 698743

118476-85-0 DALDA L-Lysinamide, L-tyrosyl-D-arginyl-L-phenylalanyl- Tyr-arg-phe-lys-NH2 tyrosyl-arginyl-phenylalanyl-lysinamide

pdb file: 698744.pdb
sdf file: 698744.sdf
directory: 698744

126675-52-3 Ala-pro-gly-trp-NH2 Apgw-amide L-Alanyl-L-prolylglycyl-L-tryptophanamide L-Tryptophanamide, L-alanyl-L-prolylglycyl- alanyl-prolyl-glycyl-tryptophanamide

pdb file: 698745.pdb
sdf file: 698745.sdf
directory: 698745

97559-35-8 L-Methioninamide, L-alpha-aspartyl-L-seryl-L-phenylalanyl-L-valylglycyl-L-leucyl- Nka-(4-10) neurokinin A(4-10)

pdb file: 698753.pdb
sdf file: 698753.sdf
directory: 698753

105806-65-3 126721-07-1 L-Prolinamide, N-methyl-D-phenylalanyl-N-(4-((aminoiminomethyl)amino)-1-formylbutyl)-, (S)- LY 294468 efegatran

pdb file: 698794.pdb
sdf file: 698794.sdf
directory: 698794

130982-43-3 Ac-Phe-pro-boroarg-OH Dup 714 Dup-714 L-Prolinamide, N-acetyl-D-phenylalanyl-N-(4-((aminoiminomethyl)amino)-1-boronobutyl)-, (S)- acetylphenylalanyl-prolyl-boroarginine

pdb file: 698826.pdb
sdf file: 698826.sdf
directory: 698826

(D-Tyr(1))CM-5 4-Pro-casomorphin 72122-63-5 Casomorphin, pro(4)- D-Pro(4)-casomorphin Deprolorphin Glycine, N-(1-(N-(1-L-tyrosyl-L-prolyl)-L-phenylalanyl)-L-prolyl)- L-Pro(4)-casomorphin Tyr-pro-phe-pro-gly Tyrosyl-prolyl-phenylalanyl-prolylglycine beta-casomorphin 5

pdb file: 698849.pdb
sdf file: 698849.sdf
directory: 698849

1-((beta-Mercapto-beta)beta cyclopentamethylenepropionic acid)-2-(O-ethyl-tyr)-4-val-9-des-gly-arginine vasopressin 1-(beta-Mercapto-beta-cyclopentamethylenepropionic acid)-2-(O-ethyl-tyr)-4-val-9-des-gly-argipressin 90332-82-4 Argipressin, beta-mercapto-(beta,beta)-cyclopentamethylenepropionic acid(1)-O-ethyltyrosyl(2)-valyl(4)-deglycine(9)- Desgly-d(CH2)5-tyr(Et)valavp Desgly-d(CH2)5-tyr(Et)vavp L-Argininamide, O-ethyl-N-((1-mercaptocyclohexyl)acetyl)-D-tyrosyl-L-phenylalanyl-L-valyl-L-asparaginyl-L-cysteinyl-L-prolyl-, cyclic (1-5)-disulfide Mcp-tva-argipressin SK&F 101926 SK&F 10196 SK&F-101926 Skf 101926 Vasopressin, beta-mercapto-beta,beta-cyclopentamethylenepropionic acid(1)-O-ethyltyrosyl(2)-valyl(4)-arginyl(8)-deslycine(9)- Vasopressin,(beta-mercapto-beta)beta-cyclopentamethylenepropionic acid(1)-O-ethyl-tyr(2)-val(4)-arg(8)-des-gly(9)- d(CH2)5(1),Tyr(Et)(2),val(4),des-gly(9)-avp

pdb file: 698852.pdb
sdf file: 698852.sdf
directory: 698852

29701-43-7 Glycinamide, N-acetyl-L-phenylalanyl- N-Acetyl-phe-gly-amide N-Acetylphenylalanylglycinamide

pdb file: 699059.pdb
sdf file: 699059.sdf
directory: 699059

99273-04-8 Cks 17 Cks-17 Cks-17 peptide L-Leucine, L-leucyl-L-glutaminyl-L-asparaginyl-L-arginyl-L-arginylglycyl-L-leucyl-L-alpha-aspartyl-L-leucyl-L-leucyl-L-phenylalanyl-L-leucyl-L-lysyl-L-alpha-glutamylglycylglycyl-

pdb file: 699186.pdb
sdf file: 699186.sdf
directory: 699186

142629-81-0 3'-Azidothymidine-5'-(phenylmethoxyalanyl)phosphate Azt-pmap L-Alanine, N-(3'-azido-3'-deoxy-P-phenyl-5'-thymidylyl)-, methyl ester N-(3'-Azido-3'-deoxy-P-phenyl-5'-thymidylyl)-L-alanine methyl ester

pdb file: 699205.pdb
sdf file: 699205.sdf
directory: 699205

150351-30-7 L-Norvalinamide, N-(4-morpholinylsulfonyl)-L-phenylalanyl-N-(4-((butylamino)carbonyl)-1-(cyclohexylmethyl)-2-hydroxy-5-methylhexyl)-4,5-didehydro-, (1S-(1R*,2R*,4R*))- PD 134922 PD-134922

pdb file: 699217.pdb
sdf file: 699217.sdf
directory: 699217

152835-17-1 L-Cysteinyl-L-leucylglycyl-L-isoleucylglycyl-L-seryl-L-cysteinyl-L-asparaginyl-L-alpha-aspartyl-L-phenylalanyl-L-alanylglycyl-L-cysteinylglycyl-L-tyrosyl-L-alanyl-L-valyl-L-valyl-L-cysteinyl-L-phenylalanyl-L-tryptophen cyclic(9-1)-peptid L-Tryptophen, L-cysteinyl-L-leucylglycyl-L-isoleucylglycyl-L-seryl-L-cysteinyl-L-asparaginyl-L-alpha-aspartyl-L-phenylalanyl-L-alanylglycyl-L-cysteinylglycyl-L-tyrosyl-L-alanyl-L-valyl-L-valyl-L-cysteinyl-L-phenylalanyl-, cyclic(9-1)-peptid RP 71955 RP-71955

pdb file: 699218.pdb
sdf file: 699218.sdf
directory: 699218

23152-29-6 EINECS 245-462-6 N-((3-Hydroxy-2-pyridinyl)carbonyl)-L-threonyl-D-alpha-aminobutyryl-L-prolyl-N-methyl-L-phenylalanyl-4-oxo-L-pipecoloyl-L-2-phenylglycine rho-lactone N-(3-Hydroxypicolinoyl)-L-threonyl-D-alpha-aminobutyryl-L-prolyl-N-methyl-L-phenylalanyl-4-oxo-L-pipecoloyl-L-2-phenylglycine rho-lactone NSC 177858 Virginiamycin S1 Virginiamycin factor S

pdb file: 699286.pdb
sdf file: 699286.sdf
directory: 699286

110655-58-8 1405-39-6 Antibiotic NSC-71936 Cinnamycin Lanthiopeptin Lysine, cysteinylarginylglutaminylcysteinylcysteinylphenylalanylphenylalanylglycylprolyl-3-aminoalanyl-3-mercapto-2-aminobutanoylphenylalanylvalylcysteinyl-3-hydroxy-alpha-aspartylglycylasparaginyl-3-mercapto-2-aminobutanoyl-, cyclic (1-18),(4-14), (5-11)-tris(sulfide), cyclic (10-19)-imine NSC 71936 NSC-71936 Ro 09-0198 Ro-09-0198

pdb file: 699306.pdb
sdf file: 699306.sdf
directory: 699306

80801-26-9 Antrimycin Antrimycin A Cirratiomycin B L-Serine, 2-(hydroxymethyl)seryl-L-alanyl-L-erythro-alpha,beta-diaminobutyryl-L-2,3,4,5-tetrahydro-3-pyridazinecarbonyl-L-alanyl-(E)-2,3-didehydroisoleucyl-

pdb file: 699430.pdb
sdf file: 699430.sdf
directory: 699430

145672-81-7 Cetrorelix acetate Cetrotide D 20761 D-Alaninamide, N-acetyl-3-(2-naphthalenyl)-D-alanyl-4-chloro-D-phenylalanyl-3-(3-pyridinyl)-D-alanyl-L-seryl-L-tyrosyl-N5-(aminocarbonyl)-D-ornithyl-L-leucyl-L-arginyl-L-prolyl-, acetate (salt) NS 75a SB 075 acetate

pdb file: 700324.pdb
sdf file: 700324.sdf
directory: 700324

123246-29-7 124904-93-4 D-Alaninamide, N-acetyl-3-(1-naphthalenyl)-D-alanyl-4-chloro-D-phenylalanyl-3-(3-pyridinyl)-D-alanyl-L-seryl-L-tyrosyl-N6-(bis(ethylamino)methylene)-D-lysyl-L-leucyl-N6-(bis(ethylamino)methylene)-L-lysyl-L-prolyl- Ganirelix Ganirelixum [INN-Latin]

pdb file: 700328.pdb
sdf file: 700328.sdf
directory: 700328

143457-40-3 L-Alaninamide, N-(2-(2-(hydroxyamino)-2-oxoethyl)-4-methyl-1-oxopentyl)-3-(2-naphthalenyl)-L-alanyl- TAPI

pdb file: 700343.pdb
sdf file: 700343.sdf
directory: 700343

64816-19-9 D-Prolyl-L-phenylalanyl-N-(4-nitrophenyl)-L-argininamide H-D-Pro-phe-arg-p-nitroanilide H-D-Prolyl-phenylalanyl-arginine-para-nitroanilide L-Argininamide, D-prolyl-L-phenylalanyl-N-(4-nitrophenyl)- Pro-phe-arg-p-nitroanilide Prolyl-phenylalanyl-arginine-p-nitroanilide S-2302 S-2648 prolyl-phenylalanyl-arginine-4-nitroanilide

pdb file: 700408.pdb
sdf file: 700408.sdf
directory: 700408

60117-17-1 Enkephalinamide-met- L-Methioninamide, L-tyrosylglycylglycyl-L-phenylalanyl- Met-enkephalinamide Methionine enkephalinamide

pdb file: 700428.pdb
sdf file: 700428.sdf
directory: 700428

75645-19-1 L-Lysine, N(2)-(N-(N-(N-(N-(N-(N-(1-(N-L-prolyl-L-histidyl)-L-prolyl)-L-phenylalanyl)-L-histidyl)-L-phenylalanyl)-L-phenylalanyl)-L-valyl)-L-tyrosyl)- Pro-his-pro-phe-his-phe-phe-val-tyr-lys Prolyl-histidyl-prolyl-phenylalanyl-histidyl-phenylalanyl-phenylalanyl-valyl-tyrosyl-lysyl renin inhibitory peptide

pdb file: 700476.pdb
sdf file: 700476.sdf
directory: 700476

(D-Trp(2)-D-phe(5))ghrp 87616-84-0 GH-Releasing hexapeptide 6 GH-Releasing peptide Ghrp, his(1)-lys(6)- Ghrp-6 Growth hormone releasing peptide His(1)-lys(6)-ghrp His-trp-ala-trp-phe-lysnh2 Histidyl-tryptophyl-alanyl-tryptophyl-phenylalanyl-lysinamide L-Lysinamide, L-histidyl-D-tryptophyl-L-alanyl-L-tryptophyl-D-phenylalanyl- SK&F 110679 SK&F-110679 Skf 110679 growth hormone releasing hexapeptide

pdb file: 700482.pdb
sdf file: 700482.sdf
directory: 700482

98035-79-1 L-Methioninamide, L-alanyl-L-arginyl-L-prolylglycyl-L-tyrosyl-L-leucyl-L-alanyl-L-phenylalanyl-L-prolyl-L-arginyl- SCPA small cardioactive peptide A

pdb file: 700483.pdb
sdf file: 700483.sdf
directory: 700483

70280-03-4 Acetylglucosaminyl-amaig D-alpha-Glutamine, N2-(N-(2-(acetylamino)-4-O-(2-(acetylamino)-2-deoxy-beta-D-glucopyranosyl)-2-deoxymuramoyl)-L-alanyl)- D-alpha-Glutamine, N2-(N-(N-acetyl-4-O-(2-(acetylamino)-2-deoxy-beta-D-glucopyranosyl)muramoyl)-L-alanyl)- Glcnac-amaig N-Acetyl-beta-D-glucosaminyl-N-acetylmuramyl-L-alanyl-D-isoglutamine N-Acetyl-beta-glucosaminyl-N-acetylmuramyl dipeptide N-Acetyl-beta-glucosaminyl-N-acmu-ala-iso-gln N-Acetylglucosaminyl (beta1-4) acetylmuramyl-L-alanyl-D-isoglutamine N-Acetylglucosaminyl (beta1-4)-muramyl dipeptide N-Acetylglucosaminyl-mdp N-acetyl-beta-glucosaminyl-N-acetylmuramyl-alanylisoglutamine

pdb file: 700505.pdb
sdf file: 700505.sdf
directory: 700505

4-10-Semax 4037-01-8 ACTH (4-10) ACTH - msh (4-10) ACTH 4-10 Adrenocorticotropic hormone 4-10 Met-glu-his-phe-arg-trp-gly Msh-acth (4-10) N-(N-(N(2)-(N-(N-(N-L-Methionyl-L-alpha-glutamyl)-L-histidyl)-L-phenylalanyl)-L-arginyl)-L-tryptophyl)glycine

pdb file: 700522.pdb
sdf file: 700522.sdf
directory: 700522

6-Arg-7-phe-met-enkephalin 73024-95-0 Enkephalin met, heptapeptide Enkephalin-met, arginyl(6)-phenylalanine(7)- L-Phenylalanine, N-(N(2)-(N-(N-(N-(N-L-tyrosylglycyl)glycyl)-L-phenylalanyl)-l-methionyl)-L-arginyl)- Met-enk-AP Met-enkephalin, arg(6)-phe(7)- Methionine-enkephalin, arg(6)-phe(7)- Tyr-gly-gly-phe-met-arg-phe Tyrosyl-glycyl-glycyl-phenylalanyl-methionyl-arginyl-phenylalanine Yggfmrf enkephalin-Met, Arg(6)-Phe(7)-

pdb file: 700524.pdb
sdf file: 700524.sdf
directory: 700524

6-Arg-7-gly-8-leu-met-enkephalin 80501-44-6 Enkephalin-met, arginyl(6)-glycyl(7)-leucine(8)- L-Leucine, N-(N-(N2-(N-(N-(N-(N-L-tyrosylglycyl)glycyl)-L-phenylalanyl)-L-methionyl)-L-arginyl)glycyl)- MEAGL Met(5)-enk-rgl Met-enk-8 Met-enkephalin, arg(6)-gly(7)-leu(8)- Methionine-enkephalin, arg(6)-gly(7)-leu(8)- Methionine-enkephalin-octapeptide Tyr-gly-gly-phe-met-arg-gly-leu Tyrosyl-glycylglycyl-phenylalanyl-methionyl-arginyl-glycyl-leucine Yggfmrgl enkephalin-Met, Arg(6)-Gly(7)-Leu(8)-

pdb file: 700526.pdb
sdf file: 700526.sdf
directory: 700526

(Ala(2))deltorphin II (Ala(2),glu(4))deltorphin 122752-16-3 Delt II Delt-II Deltorphin II Deltorphin, ala(2)-glu(4)- Deltorphin, alanyl(2)-glutamyl(4)- Deltorphin-II Glycinamide, L-tyrosyl-D-alanyl-L-phenylalanyl-L-alpha-glutamyl-L-valyl-L-valyl- Tyr-ala-phe-glu-val-val-gly-NH2 deltorphin II, Ala(2)-

pdb file: 700531.pdb
sdf file: 700531.sdf
directory: 700531

99566-27-5 F-8-F-Amide F-8-F-NH2 F8Famide FF8 (Morphine modulating peptide) Flfqpqrf-NH2 Fmrfamide-like octapeptide L-Phenylalaninamide, L-phenylalanyl-L-leucyl-L-phenylalanyl-L-glutaminyl-L-prolyl-L-glutaminyl-L-arginyl- Morphine modulating neuropeptide NPFF Neuropeptide FF Octapeptide F8FA Phe-leu-phe-gln-pro-gln-arg-phe-NH2 phenylalanyl-leucyl-phenylalanyl-glutaminyl-prolyl-glutaminyl-arginyl-phenylalaninamide

pdb file: 700533.pdb
sdf file: 700533.sdf
directory: 700533

1-13-Dynorphin A (swine) 72957-38-1 Dinorphin A (1-13) Dynorphin 1-13 Dynorphin A (1-13) L-Lysine, L-tyrosylglycylglycyl-L-phenylalanyl-L-leucyl-L-arginyl-L-arginyl-L-isoleucyl-L-arginyl-L-prolyl-L-lysyl-L-leucyl- dynorphin (1-13)

pdb file: 700561.pdb
sdf file: 700561.sdf
directory: 700561

99886-31-4 AKH (Bombyx mori) AKH-M Adipokinetic hormone (Apis mellifera ligustica) Adipokinetic hormone (heliothis zea) Adipokinetic hormone (manduca sexta) Cardioacceleratory peptide-2 Glycinamide, 5-oxo-L-prolyl-L-leucyl-L-threonyl-L-phenylalanyl-L-threonyl-L-seryl-L-seryl-L-tryptophy- Glycogen phosphorylase activating hormone H-AKH Manduca adipokinetic hormone Manduca sexta cardioacceleratory peptides Mas-AKH Pglu-leu-thr-phe-thr-ser-ser-trp-gly-NH2 adipokinetic hormone

pdb file: 700562.pdb
sdf file: 700562.sdf
directory: 700562

84746-43-0 L-Methioninamide, L-methionyl-L-asparaginyl-L-tyrosyl-L-leucyl-L-alanyl-L-phenylalanyl-L-prolyl-L-arginyl- L-Methioninamide, L-methionyl-L-asparginyl-L-tyrosyl-L-leucyl-L-alanyl-L-phenylalanyl-L-prolyl-L-arginyl- Met-asn-tyr-leu-ala-phe-pro-arg-met-NH2 Methionyl-asparaginyl-tyrosyl-leucyl-alanyl-phenylalanyl-prolyl-arginyl-methioninamide SCPB small cardioactive peptide B

pdb file: 700588.pdb
sdf file: 700588.sdf
directory: 700588

64815-81-2 Chromogenic substrate S-2238 D-Phenylalanyl-L-2-piperidinecarbonyl-N-(4-nitro phenyl)-L-argininamide H-D-Phe-pip-arg-pna H-D-Phenylalanyl-L-pipecolyl-arginine-nitroanilide H-D-Phenylalanyl-pip-arg-p-nitroanilide H-Phe-pip-arg-p-nitroanilide H-Phe-pip-arg-pna S 2238 S-2238

pdb file: 700599.pdb
sdf file: 700599.sdf
directory: 700599

2-Ala-leu-enkephalinamide 65189-64-2 D-ALE DALE Enkephalinamide-leu, alanine(2)- L-Leucinamide, L-tyrosyl-D-alanylglycyl-L-phenylalanyl- Leu-enkephalinamide, ala(2)- Leucine-enkephalinamide, ala(2)- enkephalinamide-Leu, Ala(2)-

pdb file: 700609.pdb
sdf file: 700609.sdf
directory: 700609

103667-46-5 3-Tyr-octreotide L-Cysteinamide, D-phenylalanyl-L-cysteinyl-L-tyrosyl-D-tryptophyl-L-lysyl-L-threonyl-N-(2-hydroxy-1-(hydroxymethyl)propyl)-, cyclic (2-7)-disulfide, (R-(R*,R*))- Octreotide, tyr(3)- Octreotide, tyrosine(3)- Sms 201-995, tyr(3)- Sms 204-090 Sms-204-090 Tyr(3)-sms Tyr-3-octreotide

pdb file: 700610.pdb
sdf file: 700610.sdf
directory: 700610

71901-21-8 Cho-nle-leu-phe-nle-tyr-lys F-Peptide F-chemotactic peptide FNLELFNLRYK FNLPNTL Fnle-leu-phe-nle-tyr-lys Fnorleu-leu-phe-norleu-tyr-lys Formylnorleucyl-leucyl-phenylalanyl-norleucyl-tyrosyl-lysine L-Lysine, N(2)-(N-(N-(N-(N-(N-formyl-L-norleucyl)-L-leucyl)-L-phenylalanyl)-L-norleucyl)-L-tyrosyl)- N-Formyl hexapeptide N-Formyl-nle-leu-phe-nle-tyr-lys

pdb file: 700621.pdb
sdf file: 700621.sdf
directory: 700621

(Ala(2))deltorphin I (D-Ala2)Deltorphin I 122752-15-2 Delt-I Deltorphin C Deltorphin I Glycinamide, L-tyrosyl-D-alanyl-L-phenylalanyl-L-alpha-aspartyl-L-valyl-L-valyl- Tyr-ala-phe-asp-val-val-gly-NH2 deltorphin I, Ala(2)-

pdb file: 700626.pdb
sdf file: 700626.sdf
directory: 700626

157380-72-8 Cyclo(4-oxo-4-(4-phenyl-1-piperazinyl)-L-2-aminobutanoyl-L-alpha-aspartyl-D-2-(2-thienyl)glycyl-L-leucyl-D-tryptophyl-D-alpha-aspartyl), disodium salt Cyclo(D-alpha-aspartyl-3-((4-phenylpiperazin-1-yl)carbonyl)-L-alanyl-L-alpha-aspartyl-D-2-(2-thienyl)glycyl-L-leucyl-D-tryptophyl) disodium salt Cyclo(L-alpha-aspartyl-(2R)-2-(2-thienyl)glycyl-L-leucyl-D tryptophyl-D-alpha-aspartyl-(alpha-S)-alpha-amino-gamma-oxo-4-phenyl-1-piperazinebutanoyl), disodium salt TAK 044 Tak-044

pdb file: 700630.pdb
sdf file: 700630.sdf
directory: 700630

2-Ala-met-enkephalin 61370-87-4 DAMET Dalmee Enkephalin-met, alanine(2)- L-Methionine, N-(N-(N-(N-L-tyrosyl-D-alanyl)glycyl)-L-phenylalanyl)- Met-enkephalin, ala(2)- Methionine-enkephalin, ala(2)- enkephalin-Met, Ala(2)-

pdb file: 700637.pdb
sdf file: 700637.sdf
directory: 700637

63307-63-1 D-Met(sup 2)pro(sup 5)-enkephalinamide GYKI 14238 L-Prolinamide, L-tyrosyl-D-methionylglycyl-L-phenylalanyl- L-Tyrosyl-D-methionylglycyl-L-phenylalanyl-L-prolinamide enkephalin, Met(2)-ProNH2(5)-

pdb file: 700644.pdb
sdf file: 700644.sdf
directory: 700644

39537-23-0 Ala-gln L-Glutamine, N2-L-alanyl- N(2)-L-Alanyl-L-glutamine alanylglutamine

pdb file: 700687.pdb
sdf file: 700687.sdf
directory: 700687

(Betaala(8))nka(4-10) 122063-01-8 8-beta-Ala-neurokinin A (4-10) Bala-nka (4-10) L-Methioninamide, L-alpha-aspartyl-L-seryl-L-phenylalanyl-L-valyl-beta-alanyl-L-leucyl- Neurokinin A (4-10), beta-alanine(8)- neurokinin A (4-10), beta-Ala(8)-

pdb file: 700694.pdb
sdf file: 700694.sdf
directory: 700694

81377-02-8 Cyclic(N-methyl-L-alanyl-L-tyrosyl-D-tryptophyl-L-lysyl-L-valyl-L-phenylalanyl) Cyclo(N-methyl-L-alanyl-L-tyrosyl-D-tryptophyl-L-lysyl-L-valyl-L-phenylalanyl) Seglitida [Spanish] Seglitidum [Latin] seglitide

pdb file: 700724.pdb
sdf file: 700724.sdf
directory: 700724

(Arg(0)-hyp(3)-thi(5)-phe(7)-thi(8))bradykinin 103412-42-6 111317-75-0 Arg(0)-(hyp(3)-thi(5,8)-D-phe(7))-BK Arg-3-hyp-5,8-thi-7-phe-bradykinin Arg-3-hyp-5-(2-thi-ala)-7-phe-8-(2-thi-ala)-bradykinin Arginyl-arginyl-prolyl-hydroxyprolyl-glycl-(2-thienyl)alanyl-seryl-phenylalanyl-(2-thienyl)alanyl-arginine B 4162 B 4881 B 6572 B-4162 B-4881 B-6572 B4881 Bradykinin, D-arg(0)-hyp(3)-D-phe(7)-thi(5,8) Bradykinin, arg-hyp(3)-gly-(2-thi-ala)(5)-phe(7)-(2-thi-ala)(8)- Bradykinin, arginyl-hydroxyproly(3)-(2-thienylalanyl)(5)-phenylalanyl(7)-(2-thienylalanine)(8)- D-Arg-(hyp(3),thi(5,8),D-phe(7))bradykinin L-Arginine, N2-(N-(N-(N-(N-(N-(1-(1-(N2-D-arginyl-L-arginyl)-L-prolyl)-trans-4-hydroxy-L-prolyl)glycyl)-3-(2-thienyl)-L-alanyl)-L-seryl)-D-phenylalanyl)-3-(2-thienyl)-L-alanyl)- Npc 349

pdb file: 700726.pdb
sdf file: 700726.sdf
directory: 700726

56236-83-0 ACTH (4-9) Acth 4-9 L-Tryptophan, N-(N(2)-(N-(N-(N-L-methionyl-L-alpha-glutamyl)-L-histidyl)-L-phenylalanyl)-L-arginyl)-

pdb file: 700750.pdb
sdf file: 700750.sdf
directory: 700750

(Pglu(5),Me-phe(8),sar(9))substance P-(5-11) (Pglu(5)-mephe(8)-sar(9))SP (5-11) 5-Pglu-8-mephe-9-megly-substance P (5-11) 77128-69-9 Dime-C7 Dimethyl C7 L-Methioninamide, 5-oxo-L-prolyl-L-glutaminyl-L-phenylalanyl-N-methyl-L-phenylalanyl-N-methylglycyl-L-leucyl- Substance P (5-11), pglu(5)-mephe(8)-sar(9)- Substance P (5-11), pyroglutamyl(5)-methylphenylalanyl(8)-methylglycine(9)- substance P (5-11), pGlu(5)-MePhe(8)-MeGly(9)-

pdb file: 700751.pdb
sdf file: 700751.sdf
directory: 700751

37933-92-9 Chromatophorotropin, red-pigment concentrating (pandalus borealis) Chromatophorotropin, red-pigment-concentrating (pandalus borealis) Crustacean erythrophore concentrating hormone Pyroglutamyl-leucyl-asparginyl-phenylalanyl-seryl-prolyl-glycyl-tryptophanamide RPCH Red pigment concentrating hormone p-Glu-leu-asn-phe-ser-pro-gly-trp-amide red pigment-concentrating hormone

pdb file: 700756.pdb
sdf file: 700756.sdf
directory: 700756

155761-99-2 L-Cysteine, L-phenylalanyl-L-leucylglycylglycyl-L-leucyl-L-isoleucyl-L-lysyl-L-isoleucyl-L-valyl-L-prolyl-L-alanyl-L-methionyl-L-isoleucyl-L-cysteinyl-L-alanyl-L-valyl-L-threonyl-L-lysyl-L-lystyl-, cyclic(14-20)-disulfide L-Phenylalanyl-L-leucylglycylglycyl-L-leucyl-L-isoleucyl-L-lysyl-L-isoleucyl-L-valyl-L-prolyl-L-alanyl-L-methionyl-L-isoleucyl-L-cysteinyl-L-alanyl-L-valyl-L-threonyl-L-lysyl-L-lystyl-L-cysteine cyclic(14-20)-disulfide Ranalexin

pdb file: 700818.pdb
sdf file: 700818.sdf
directory: 700818

159519-65-0 262434-79-7 DP178 Dp 178 Enfuvirtide Fuzeon L-Phenylalaninamide, N-acetyl-L-tyrosyl-L-threonyl-L-seryl-L-leucyl-L-isoleucyl-L-histidyl-L-seryl-L-leucyl-L-isoleucyl-L-alpha-glutamyl-L-alpha-glutamyl-L-seryl-L-glutaminyl-L-asparaginyl-L-glutaminyl-L-glutaminyl-L-alpha-glutamyl-L-lysyl-L-asparaginyl-L-alpha-glutamyl-L-glutaminyl-L-alpha-glutamyl-L-leucyl-L-leucyl-L-alpha-glutamyl-L-leucyl-L-alpha-aspartyl-L-lysyl-L-tryptophyl-L-alanyl-L-seryl-L-leucyl-L-tryptophyl-L-asparaginyl-L-tryptophyl- Pentafuside T 20 T 20 (peptide) T-20 T20

pdb file: 700862.pdb
sdf file: 700862.sdf
directory: 700862

120318-94-7 Calcitonin (salmon reduced), 1-(N-(1-oxopropyl)-L-alanine)-7-L-alanine-19-de-L-leucine- Calcitonin, salmon, N(alpha)-propionyl di-ala(1,7)-des-leu(19)- Calcitonin, salmon, N(alpha)-propionyl-dialanyl(1,7)-de-leucine (19)- N(alpha)-Propionyl-1,7-di-ala-19-des-leu-salmon calcitonin RG 12851 RG-12851

pdb file: 700889.pdb
sdf file: 700889.sdf
directory: 700889

137084-95-8 Biotin-lys-tyr-gly-gly-gly-gly-gly-gly-arg-pro-arg-pro-gln-gln-phe-phe-gly-leu-met-amide Biotin-nte-3-arg-substance P L-Methioninamide, L-lysyl-L-tyrosylglycylglycylglycylglycylglycylglycyl-L-arginyl-L-prolyl-L-arginyl-L-prolyl-L-glutaminyl-L-glutaminyl-L-phenylalanyl-L-phenylalnylglycyl-L-leucyl- Substance P, biotin-nte-arg(3)- Substance P, biotin-nte-arginine(3)-

pdb file: 700890.pdb
sdf file: 700890.sdf
directory: 700890

115082-72-9 Angiotensin II, 1-(N-(6-((5-(hexahydro-2-oxo-1H-thieno(3,4-d)imidazol-4-yl)-1-oxopentyl)amino)-1-oxohexyl)-L-alanine)-5-L-isoleucine-8-(4-azido-L-phenylalanine)-, (3aS-(3aalpha,4beta,6aalpha))- Bio-epsilon-ahx-ala-arg-val-tyr-ile-his-pro-phe(4N3)-OH Biotin-nonapeptide Biotinyl-epsilon-aminohexanoyl-alanyl-arginyl-valyl-tyrosyl-isoleucyl-histidyl-prolyl-phenylalanyl(4N3)-hydroxy

pdb file: 700892.pdb
sdf file: 700892.sdf
directory: 700892

53342-16-8 Chlamydocin Cyclic(2-methylalanyl-L-phenylalanyl-D-propyl-L-alpha-amino-eta-oxooxiraneoctanoyl)

pdb file: 700913.pdb
sdf file: 700913.sdf
directory: 700913

55533-06-7 Adg-lhrhpa D-Ala(6)-des-gly(10)-LHRH propylamide D-Alanyl-desglycine-propylamide-LHRH LHRH propylamide, ala(6)-des-gly(10)- Luteinizing hormone-releasing factor (pig), 6-D-alanine-9-(N-propyl-L-prolinamide)-10-deglycinamide-

pdb file: 701072.pdb
sdf file: 701072.sdf
directory: 701072

56121-42-7 Asperglaucide Aurantiamide acetate Lyciumamide N-Benzoyl-1-phenylalanyl-1-phenylalaninol acetate N-Benzoyl-L-phenylalanyl-L-phenylalinol acetate N-Benzoyl-phe-phe-ol-acetate N-Benzoylphenylalanylphenylalinol acetate

pdb file: 701100.pdb
sdf file: 701100.sdf
directory: 701100

126642-86-2 Ile-phe-lys-CH2Cl Isoleucyl-phenylalanyl-lysine chloromethyl ketone L-Phenylalaninamide, L-isoleucyl-N-(5-amino-1-(chloroacetyl)pentyl)-, (S)-

pdb file: 701177.pdb
sdf file: 701177.sdf
directory: 701177

91269-93-1 D-Leucine, N-(N-(N-(N-(1-(N-L-valyl-D-leucyl)-L-prolyl)-L-phenylalanyl)-L-phenylalanyl)-L-valyl)-, (E)- Val-leu-pro-phe-phe-val-leu Valyl-leucyl-prolyl-phenylalanyl-phenylalanyl-valyl-leucine

pdb file: 701394.pdb
sdf file: 701394.sdf
directory: 701394

60230-18-4 D-Alanine, N-(N-acetyl-4-O-(2-(acetylamino)-2-deoxy-beta-D-glucopyranosyl)muramoyl)-L-alanyl-D-gamma-glutamyl-meso-alpha,epsilon-diaminopimelyl- Disaccharide tetrapeptide G(Anh)mtetra N-Acetylglucosaminyl-N-acetylmuraminyl-L-alanyl-gamma-D-glutaminylmesodiaminopimelyl-D-alanine N-Acetylglucosaminyl-N-acmu-ala-gamma-gln-mesodiaminopimelyl-ala

pdb file: 701466.pdb
sdf file: 701466.sdf
directory: 701466

60283-51-4 Butanoic acid, L-tyrosylglycylglycyl-L-phenylalanyl-gamma-(methylsulfinyl)-L-alpha-amino- Enkephalin-met, sulfoxide- Met-enkephalin sulfoxide Methionine enkephalin sulfoxide Oxidized methionine enkephalin

pdb file: 701470.pdb
sdf file: 701470.sdf
directory: 701470

60355-77-3 D-alpha-Glutamine, N2-(N-(N-acetylmuramoyl)glycyl)- DM-Mdp Desmethylmuramyl dipeptide N-Acetyl-demethylmuramyl-L-alanyl-D-isoglutamine N-Acetyl-demethylmuramyl-alanyl-isoglutamine Normdp

pdb file: 701472.pdb
sdf file: 701472.sdf
directory: 701472

6-O-Stearoyl-N-acetylmuramyl-alanylisoglutamine 6-O-Stearoyl-N-acmu-ala-iso-gln 6-O-Stearoyl-muramyl dipeptide 6-Smdp 60398-08-5 D-alpha-Glutamine, N2-(N-(N-acetyl-6-O-(1-oxooctadecyl)muramoyl)-L-alanyl)- L18-Mdp(ala)

pdb file: 701475.pdb
sdf file: 701475.sdf
directory: 701475

60503-05-1 Gyki 14,166 Gyki 14166 H-D-Phe-pro-arginal L-Prolinamide, D-phenylalanyl-N-(4-((aminoiminomethyl)amino)-1-formylbutyl)-, (S)- Rgh 2958

pdb file: 701480.pdb
sdf file: 701480.sdf
directory: 701480

91870-20-1 Formyl-(phenylalanyl)(6)-phenylalanine methyl ester Hco-(phe)7-ome L-Phenylalanine, N-(N-(N-(N-(N-(N-(N-formyl-L-phenylalanyl)-D-phenylalanyl)-L-phenylalanyl)-D-phenylalanyl)-L-phenylalanyl)-D-phenylalanyl)-, (Z,E,E,E,E)-

pdb file: 701521.pdb
sdf file: 701521.sdf
directory: 701521

91870-41-6 Cyclo(pro-phe-aca) Cyclo(prolylphenylalanyl-epsilon-aminocaproyl)

pdb file: 701522.pdb
sdf file: 701522.sdf
directory: 701522

00700001_00725000/701527 91926-58-8 Cyclo(phe-pro-aca) Cyclo(phenylalanylprolyl-epsilon-aminocaproyl)

pdb file: 701526.pdb
sdf file: 701526.sdf
directory: 701526

00700001_00725000/701535 91999-74-5 Angiotensinogen, 5-L-isoleucine-11-L-valine-12-L-isoleucine-13-L-histidine-, (3alpha,5beta,7alpha,12alpha)- H-Asp-arg-val-tyr-ile-his-pro-phe-his-leu-val-ile-ser-OH H-Asparaginyl-arginyl-valyl-tyrosyl-isoleucyl-histyl-prolyl-phenylalanyl-histyl-leucyl-valyl-isoleucyl-serine SHAT Serine human angiotensin tetradecapeptide

pdb file: 701534.pdb
sdf file: 701534.sdf
directory: 701534

1-Tyr sulfate-2-ala-met-enkephalinamide 92175-45-6 Enkephalinamide-met, tyr sulfate(1)-ala(2)- Enkephalinamide-met, tyrosyl sulfate(1)-alanine(2)- L-Methioninamide, O-sulfo-L-tyrosyl-D-alanylglycyl-L-phenylalanyl-, (3aS-(3aalpha,4beta,6aalpha))- METSA Met-enkephalinamide, tyr sulfate(1)-ala(2)- Methionine-enkephalinamide, tyr sulfate(1)-ala(2)-

pdb file: 701554.pdb
sdf file: 701554.sdf
directory: 701554

92237-18-8 C-MT Peptide L-Phenylalanine, N-(N-(N2-(N-(N2-(N2-(N-(N-(N-(N-(N-L-methionyl-L-leucyl)-L-phenylalanyl)-L-isoleucyl)-L-leucyl)-L-isoleucyl)-L-lysyl)-L-arginyl)-L-seryl)-L-arginyl)-L-histidyl)-, (SP-4-2)- Met-leu-phe-ile-lys-arg-ser-arg-his-phe Methionyl-leucyl-phenylalanyl-isoleucyl-lysyl-arginyl-seryl-arginyl-histidyl-phenylalanine Mlpilasahp

pdb file: 701591.pdb
sdf file: 701591.sdf
directory: 701591

103711-74-6 3-Cl-Ala-3-Cl-ala-3-Cl-ala beta-Chloroalanyl-beta-chloroalanyl-beta-chloroalanine

pdb file: 701605.pdb
sdf file: 701605.sdf
directory: 701605

103719-15-9 Poly(phe-A-G-gly) Poly(phe-ala-glu-gly) Poly(phenylalanyl-alanyl-glutamyl-glycine)

pdb file: 701607.pdb
sdf file: 701607.sdf
directory: 701607

103834-43-1 Tagppl Tyr-ala-gly-phe-psi(CH2S)leu-OH Tyrosyl-alanyl-glycyl-phenylalanyl-psi(thiomethylene)leucine

pdb file: 701617.pdb
sdf file: 701617.sdf
directory: 701617

103881-76-1 Tclgpl Tyr-cyclo(lys-gly-phe-psi(CH2S)leu) Tyrosyl-cyclo(lysyl-glycyl-phenylalanyl-psi(thiomethylene)leucine)

pdb file: 701627.pdb
sdf file: 701627.sdf
directory: 701627

2-Acetamido-3-O-((((1S)-1-(((1R)-1-carbamoyl-3-carboxypropyl)carbamoyl)ethyl)carbamoyl)methyl)-2-deoxy-D-glucopyranose 61136-12-7 Almurtide [BAN:INN] Cgp 11637 Cgp-11637 D-alpha-Glutamine, N2-(N-(N-acetylnormuramoyl)-L-alanyl)- N-Acetyl-nor-muramyl-L-alanyl-D-isoglutamine Nor-MDP

pdb file: 701645.pdb
sdf file: 701645.sdf
directory: 701645

92899-39-3 Glycine, N-(1-(N-(N-(N-L-valylglycyl)-L-valyl)-L-alanyl)-L-prolyl)-, (SP-4-2)- Val-gly-ala-pro-gly Valyl-glycyl-valyl-alanyl-prolyl-glycine Vgvapg

pdb file: 701704.pdb
sdf file: 701704.sdf
directory: 701704

63014-08-4 D-Arginine, N(2)-(N(2)-(N-(N-(N-(N-(N(2)-(1-(2,4-dinitrophenyl)-L-prolyl)-L-glutaminyl)glycyl)-L-isoleucyl)-L-alanyl)glycyl)-L-glutaminyl)- Dnp-peptide EINECS 263-790-8 N2-(N2-(N-(N-(N-(N-(N2-(1-(2,4-Dinitrophenyl)-L-prolyl)-L-glutaminyl)glycyl)-L-isoleucyl)-L-alanyl)glycyl)-L-glutaminyl)-D-arginine

pdb file: 701733.pdb
sdf file: 701733.sdf
directory: 701733

(S)-N-(3,3,3-Trifluoro-2-oxo-1-(phenylmethyl)propyl)acetamide 128656-63-3 Ac-Phe-CF3 Acetamide, N-(3,3,3-trifluoro-2-oxo-1-(phenylmethyl)propyl)-, (S)- Acetyl-phenylalanyl trifluoromethyl ketone

pdb file: 701741.pdb
sdf file: 701741.sdf
directory: 701741

63244-88-2 Benzyloxycarbonyl-alanyl-alanyl-lysyl-4-methoxy-2-naphthylamide L-Lysinamide, N-((phenylmethoxy)carbonyl)-L-alanyl-L-alanyl-N-(4-methoxy-2-naphthalenyl)- Z-Ala-ala-lys-mna

pdb file: 701755.pdb
sdf file: 701755.sdf
directory: 701755

93208-51-6 Chromatophorotropin, red-pigment-concentrating (pandalus borealis) 2-L-valine-7-L-asparagine-, (SP-4-2)- Glu-val-asn-phe-ser-pro-asn-trp-NH2 Glutamyl-valyl-asparaginyl-phenylalanyl-seryl-prolyl-asparaginyl-tryptophanamide Gvapspat amide Hypertrehalosemic hormone I Hypertrehalosemic peptide I Neurohormone D Neurohormone D, periplaneta americana Pea-cah-I

pdb file: 701786.pdb
sdf file: 701786.sdf
directory: 701786

93240-39-2 Chromatophorotropin, red-pigment-concentrating (Pandalus borealis) 3-L-threonine-5-L-threonine-7-L-asparagine- Chromatophorotropin, red-pigment-concentrating (pandalus borealis) 3-L-threonine-5-L-threonine-7-L-asparagine-, (SP-4-2)- Gltptpat amide Glu-leu-thr-phe-thr-pro-asn-trp-NH2 Glutamyl-leucyl-threonyl-phenylalanyl-threonyl-prolyl-asparaginyl-tryptophanamide Hypertrehalosemic hormone II Hypertrehalosemic peptide II

pdb file: 701793.pdb
sdf file: 701793.sdf
directory: 701793

93240-95-0 L-Phenylalanine, N-acetyl-, monoanhydride with 5'-adenylic acid N-Ac-Phe-amp-anh N-Acetyl-L-phenylalanine monoanhydride with 5'-adenylic acid N-Acetylphenylalanyl-adenosine monophosphate-anhydride

pdb file: 701798.pdb
sdf file: 701798.sdf
directory: 701798

2-(Phenylalanylglycyl)amino-3-(4-nitrophenyl)-1,3-propanediol 93359-23-0 Glycinamide, L-phenylalanyl-N-(2-hydroxy-1-(hydroxymethyl)-2-(4-nitrophenyl)ethyl)-, (R-(R*,R*))- PG-Chloramphenicol

pdb file: 701816.pdb
sdf file: 701816.sdf
directory: 701816

93753-74-3 N-Benzyloxycarbonylalanyl-arginyl-arginyl-4-trifluoromethyl-7-coumarylamide Z-Ala-arg-arg-afc

pdb file: 701834.pdb
sdf file: 701834.sdf
directory: 701834

93772-67-9 L-Valine, N-(N-(N-L-tyrosyl-L-isoleucyl)-L-phenylalanyl)-, (R-(R*,S*-(E)))- TIPV Tyr-ile-phe-val Tyrosyl-isoleucyl-phenylalanyl-valine

pdb file: 701839.pdb
sdf file: 701839.sdf
directory: 701839

7-Lys-ala-4-mca 7-Lysylalanyl-4-methylcoumarinamide 94149-28-7 L-Alaninamide, L-lysyl-N-(4-methyl-2-oxo-2H-1-benzopyran-7-yl)- Lys-ala-NH-mec Lysyl-alaninamide 4-methylcoumarin

pdb file: 701867.pdb
sdf file: 701867.sdf
directory: 701867

(R)-N-(4-Methoxy-1,4-dioxobutyl)-L-alanyl-L-alanyl-N-(1-borono-2-methylpropyl)-L-prolinamide 94242-73-6 L-Prolinamide, N-(4-methoxy-1,4-dioxobutyl)-L-alanyl-L-alanyl-N-(1-borono-2-methylpropyl)-, (R)- Maap-borov Meosuc-ala-ala-pro-boroval O-Methyl-succinyl-alanyl-alanyl-prolyl-borovaline

pdb file: 701891.pdb
sdf file: 701891.sdf
directory: 701891

94492-33-8 Tyr-ala-gly-phe-cys(Et) Tyrosyl-alanyl-glycyl-phenylalanyl-cysteine S-ethyl ester

pdb file: 701926.pdb
sdf file: 701926.sdf
directory: 701926

94492-35-0 Tyr-ala-gly-phe-cys(Bu) Tyrosyl-alanylglycyl-phenylalanyl-cysteine S-butyl ester

pdb file: 701927.pdb
sdf file: 701927.sdf
directory: 701927

65147-22-0 Benzyloxycarbonyl-phe-arg 4-methyl-7-coumarylamide Benzyloxycarbonyl-phenylalanylarginine-4-methylcoumaryl-7-amide Carbobenzoxy-L-phenylalanyl-L-arginine 4-methylcoumarinyl-7-amide Cbz-phe-arg-mca L-Argininamide, N-((phenylmethoxy)carbonyl)-L-phenylalanyl-N-(4-methyl-2-oxo-2H-1-benzopyran-7-yl)- Z-Phe-arg-4-nmec Z-Phe-arg-amc Zfrn-mec

pdb file: 701949.pdb
sdf file: 701949.sdf
directory: 701949

65178-14-5 Benzyloxycarbonylphenylalanylphenylalanine diazomethyl ketone Carbamic acid, ((1S)-2-(((1S)-3-diazo-2-oxo-1-(phenylmethyl)propyl)amino)-2-oxo-1-(phenylmethyl)ethyl)-, phenylmethyl ester Carbamic acid, (2-((3-diazo-2-oxo-1-(phenylmethyl)propyl)amino)-2-oxo-1-(phenylmethyl)ethyl)-, phenylmethyl ester, (S-(R*,R*))- Z-Phe-phe-chn2

pdb file: 701952.pdb
sdf file: 701952.sdf
directory: 701952

95237-86-8 Gln-ala-thr-val-gly-asp-val-asn-thr-asp-arg-pro-gly-leu-leu-asp-leu-lys L-Lysine, L-glutaminyl-L-alanyl-L-threonyl-L-valylglycyl-L-alpha-aspartyl-L-valyl-L-asparaginyl-L-threonyl-L-alpha-aspartyl-L-arginyl-L-prolylglycyl-L-leucyl-L-leucyl-L-alpha-aspartyl-L-leucyl- ODNP Octadecaneuropeptide

pdb file: 702038.pdb
sdf file: 702038.sdf
directory: 702038

1-(N-Acetylmuramyl-alanyl-isoglutaminyl)-2,3-dipalmitoyl-sn-glycerol 95238-29-2 D-alpha-Glutamine, N2-(N-(N-acetylmuramoyl)-L-alanyl)-, (+)- Mdp-gdp Muramyl dipeptide-glyceryldipalmitate

pdb file: 702039.pdb
sdf file: 702039.sdf
directory: 702039

95153-19-8 L-Serine, N-L-alanyl-, diazoacetate (ester) LL D05139(beta) LL-D05139(beta) LL-D05139beta

pdb file: 702046.pdb
sdf file: 702046.sdf
directory: 702046

95210-75-6 Human beta casomorphin 8 L-Proline, 1-(N-(1-(N-(N-(N-(1-L-tyrosyl-L-prolyl)-L-phenylalanyl)-L-valyl)-L-alpha-glutamyl)-L-prolyl)-L-isoleucyl)- Pro-tyr-pro-phe-val-glu-pro-ile-NH2 Prolyl-tyrosyl-prolyl-phenylalanyl-valyl-glutamyl-prolyl-isoleucinamide beta-Casomorphin 8, human

pdb file: 702052.pdb
sdf file: 702052.sdf
directory: 702052

1-Asn-5-val-9-gly-angiotensin I 95211-04-4 Angiotensin I, 1-L-aspargagine-5-L-valine-9-glycine- Angiotensin I, asn(1)-val(5)-gly(9)- Angiotensin I, asparaginyl(1)-valyl(5)-glycine(9)- Avga I L-Leucine, L-asparaginyl-L-arginyl-L-valyl-L-tyrosyl-L-valyl-L-histidyl-L-prolyl-L-phenylalanylglycyl-

pdb file: 702067.pdb
sdf file: 702067.sdf
directory: 702067

95416-28-7 Aaasplall Ala-ala-ala-ser-phe-lys-ala-lys-lys-NH2 Alanyl-alanyl-alanyl-seryl-phenylalanyl-lysyl-alanyl-lysyl-lysinamide

pdb file: 702090.pdb
sdf file: 702090.sdf
directory: 702090

95537-14-7 AZ-Damge L-Phenylalaninamide, L-tyrosyl-D-alanylglycyl-4-azido-N-(2-hydroxyethyl)-Nalpha-methyl-, mono(trifluoroacetate) (salt) L-Phenylalaninamide, L-tyrosyl-D-alanylglycyl-4-azido-N-(2-hydroxyethyl)-nalpha-methyl-, (1alpha,5Z,7E)- Tyr-ala-gly-4-azido-mephe-gly-OH Tyrosyl-alanyl-glycyl-(4-azidomethylphenylalanyl)-glycine-OH

pdb file: 702113.pdb
sdf file: 702113.sdf
directory: 702113

95537-15-8 AZ-Dtlet L-Threonine, N-(N-(4-azido-N-(N-(N-L-tyrosyl-D-threonyl)glycyl)-L-phenylalanyl)-L-leucyl)-, (1alpha,5Z,7E)- Tyr-thr-gly-4-azido-phe-leu-thr Tyrosyl-threonyl-glycyl-(4-azidophenylalanyl)-leucyl-threonine

pdb file: 702114.pdb
sdf file: 702114.sdf
directory: 702114

133083-20-2 L-Lysine, N2-beta-alanyl-N6-(4-amino-2-hydroxybutyl)-, (R)- alpha-(beta-Alanyl)hypusine

pdb file: 702334.pdb
sdf file: 702334.sdf
directory: 702334

95602-96-3 Cahlag Chloroacetyl-N-hydroxyleucyl-alanyl-glycinamide ClCH2CO-DL-(N-OH)leu-ala-gly-NH2 ClCH2CO-holeu-ala-gly-NH2 Glycinamide, N-(chloroacetyl)-N-hydroxy-L-leucyl-L-alanyl- N-(Chloroacetyl)-N-hydroxy-L-leucyl-L-alanylglycinamide

pdb file: 702359.pdb
sdf file: 702359.sdf
directory: 702359

66556-73-8 Boc-phe-leu-phe-leu-phe Bplplp Butyloxycarbonyl-phe-leu-phe-leu-phe Butyloxycarbonyl-phenylalanyl-leucyl-phenylalanyl-leucyl-phenylalanine L-Phenylalanine, N-(N-(N-(N-(N-((1,1-dimethylethoxy)carbonyl)-L-phenylalanyl)-D-leucyl)-L-phenylalanyl)-D-leucyl)- N-Tertiary-butyloxycarbonyl-phenylalanyl-leucyl-phenylalanyl-leucyl-phenylalanine N-t-Boc-phe-dleu-phe-dleu-phe N-t-Boc-phe-leu-phe-leu-phe

pdb file: 702378.pdb
sdf file: 702378.sdf
directory: 702378

(B30)-Mdp 6-O-(2-Tetradecyl-hexadecanoyl)-N-mdp 6-O-(2-Tetradecylhexadecanoyl)-N-acetylmuramyl-L-alanyl-D-isoglutamine 66880-80-6 B 30-Muramyl dipeptide D-alpha-Glutamine, N2-(N-(N-acetyl-6-O-(1-oxo-2-tetradecylhexadecyl)muramoyl)-L-alanyl)-

pdb file: 702397.pdb
sdf file: 702397.sdf
directory: 702397

95676-71-4 Basacv Bis((9-acridinyl)ser-ala-cys-val)dilactone disulfide Bis((9-acridinyl)seryl-alanyl-cysteinyl-valine)dilactone disulfide L-Valine, N-9-acridinyl-D-seryl-L-alanyl-L-cysteinyl-, (2S-(2alpha(R*),5alpha,6beta(1R*,2R*,3R*,4R*,5R*,6S*,9E,11S*,12S*,13E,15S*)))- L-Valine, N-9-acridinyl-D-seryl-L-alanyl-L-cysteinyl-, bimol. lactone, cyclic (3-3')-disulfide

pdb file: 702456.pdb
sdf file: 702456.sdf
directory: 702456

95722-76-2 Chitinovorin B Chitinovorin-B L-Alaninamide, L-alanyl-N-(4-((7-((5-amino-5-carboxy-1-oxopentyl)amino)-2-carboxy-7-(formylamino)-8-oxo-5-thia-1-azabicyclo(4.2.0)oct-2-en-3-yl)methoxy)-1-(3-((aminoiminomethyl)amino)propyl)-2-hydroxy-4-oxobutyl)-, (6R-(3(1S*,2R*),6alpha,7beta(R*)))-

pdb file: 702469.pdb
sdf file: 702469.sdf
directory: 702469

70669-29-3 Ige decapeptide Ige epsilon chain decapeptide (497-506) Immunoglobulin E decapeptide L-Phenylalanine, N-(N-(N-(N-(N-(N-(N-(N2-(N-L-lysyl-L-threonyl)-L-lysyl)glycyl)-L-seryl)glycyl)-L-phenylalanyl)-L-phenylalanyl)-L-valyl)-

pdb file: 702499.pdb
sdf file: 702499.sdf
directory: 702499

70706-79-5 Cyclo(aminoheptanoic acid-cyclo(cys-phe-D-trp-lys-thr-cys)) Cyclo(aminoheptanoic acid-cyclo(cysteinyl-phenylalanyl-D-tryptophyl-lysyl-threonyl-cysteinyl)) Cycloa-cyclocptltc L-Cysteine, N-(7-amino-1-oxoheptyl)-L-cysteinyl-L-phenylalanyl-D-tryptophyl-L-lysyl-L-threonyl-, cyclic (6-1)-peptide, cyclic (1-6)-disulfide Somatostatin, cycloa-cyclocptltc

pdb file: 702500.pdb
sdf file: 702500.sdf
directory: 702500

6-O-Methylbouvardin 70840-66-3 Bouvardin, 6-(3-hydroxy-N,O-dimethyl-L-tyrosine)- Cyclo(D-alanyl-L-seryl-N,O-dimethyl-L-tyrosyl-L-alanyl-N-methyl-L-tyrosyl-3-hydroxy-N,O-dimethyl-L-tyrosyl), cyclic (5(4)-6(3))-ether

pdb file: 702509.pdb
sdf file: 702509.sdf
directory: 702509

69537-64-0 Glycine, N-(N-L-tyrosyl-D-alanyl)- Tag peptide Tyr-ala-gly Tyrosyl-alanyl-glycine

pdb file: 702513.pdb
sdf file: 702513.sdf
directory: 702513

70967-97-4 L-Phenylalaninamide, N-(3-carboxy-1-oxopropyl)-L-alanyl-L-alanyl-L-prolyl-N-(4-nitrophenyl)-, (+-)- Saappna Suc-aapf-pna Suc-ala-ala-pro-phe-4-NA Succinyl-alanyl-alanyl-prolyl-phenylalanine-4-nitroanilide Succinyl-alanyl-alanyl-prolyl-phenylalanine-p-nitroanilide

pdb file: 702518.pdb
sdf file: 702518.sdf
directory: 702518

96118-75-1 Chr (9-41) Corticotropin releasing factor (9-41) Corticotropin releasing hormone (9-41) Crf(9-41) Crh (9-41) L-Alaninamide, L-alpha-aspartyl-L-leucyl-L-threonyl-L-leucyl-L-alpha-glutamyl-L-leucyl-L-leucyl-L-arginyl-L-alpha-glutamyl-L-methionyl-L-leucyl-L-alpha-glutamyl-L-methionyl-L-alpha-glutamyl-L-lysyl-L-alanyl-L-glutaminyl-L-alanyl-L-alanyl-L-leucyl-L-asparaginyl-L-arginyl-L-leucyl-L-leucyl-L-leucyl-L-alpha-glutamyl-L-alpha-glutamyl- alpha-Corticotropin releasing factor alpha-Helical crf(9-41)

pdb file: 702613.pdb
sdf file: 702613.sdf
directory: 702613

1,4,8-Triazacyclotridecane-5-carboxamide, 12-((2-amino-3-(4-hydroxyphenyl)-1-oxopropyl)amino)-3,7,13-trioxo-2-(phenylmethyl)-, (2S-(2R*,5R*,12S*,(R*)))- 96382-72-8 Cyclo(tyr-orn-phe-asp-NH2) Cyclo(tyrosyl-ornithyl-phenylalanyl-aspartamide) Cyclo-topa Cyclo-topan Tyr-D-cyclo(orn-phe-asp)-NH2 Tyrosyl-D-cyclo(ornithyl-phenylalanyl-aspartamide)

pdb file: 702674.pdb
sdf file: 702674.sdf
directory: 702674

96384-03-1 Ctp-NH2 Ctp-srih L-Threoninamide, D-phenylalanyl-L-cysteinyl-L-tyrosyl-D-tryptophyl-L-lysyl-L-(2-7)-disulfide Phe-cycl(cys-tyr-trp-lys-thr-pen)thr-NH2 Phenylalanyl-cyclo(cysteinyl-tyrosyltryptophyl-lysyl-threonyl-penicillamine)threoninamide

pdb file: 702675.pdb
sdf file: 702675.sdf
directory: 702675

96384-04-2 C2P7 L-Threoninamide, D-phenylalanyl-L-cysteinyl-L-phenylalanyl-D-tryptophyl-L-lysyl-L-threonyl-3-mercapto-D-valyl-, cyclic (2-7)-disulfide Phe-cys-phe-trp-lys-thr-pen-thr-NH2 Phe-cys-phe-trp-lys-thr-pen-thrnh2 Phenylalanyl-cysteinyl-phenylalanyl-tryptophyl-lysyl-threonyl-penicillamine-threoninamide

pdb file: 702676.pdb
sdf file: 702676.sdf
directory: 702676

96386-05-9 BPPL Boc-phe-phe-lys-H Butyloxycarbonyl-phenylalanyl-phenylalanyl-lysine L-Lysine, N2-(N-(N-(1,1-dimethylethoxy)carbonyl)-D-phenylalanyl)-L-phenylalanyl)-

pdb file: 702678.pdb
sdf file: 702678.sdf
directory: 702678

96425-84-2 D-Alanine, N-(N-(N2-L-tyrosyl-D-arginyl)-L-phenylalanyl)- H-Tyr-arg-phe-ala-OH Tyrosyl-arginyl-phenylalanyl-alanine

pdb file: 702685.pdb
sdf file: 702685.sdf
directory: 702685

96563-00-7 Pglu-leu-trp-ala-thr-gly-his-phe-met-NH2 Pyroglutamyl-leucyl-tryptophyl-alanyl-threonyl-glycyl-histidyl-phenylalanyl-methioninamide Ranatensin, 2-L-leucine-3-de-L-proline-4-de-L-glutamine-7-L-threonine- Rohdei-litorin

pdb file: 702715.pdb
sdf file: 702715.sdf
directory: 702715

2-Amino-4-formyl-3-(hydroxyaminocarbonyl)butyric acid 96565-32-1 Dealanylalahopcin L-Norvaline, 3-((hydroxyamino)carbonyl)-5-oxo-, threo-

pdb file: 702716.pdb
sdf file: 702716.sdf
directory: 702716

96608-80-9 L-Cysteinamide, D-phenylalanyl-L-cysteinyl-L-tyrosyl-D-tryptophyl-L-lysyl-L-threonyl-N-(2-hydroxy-1-(hydroxymethyl)propyl)-, cyclic (2-7)-disulfide Sdz 204-090 Sdz-204-090

pdb file: 702727.pdb
sdf file: 702727.sdf
directory: 702727

(Arg(1),phe(5),trp(7,9),leu(11))-substance P 1-D-Arginine-5-D-phenylalanine-7-D-tryptophan-9-D-tryptophan-11-L-leucinamide- substance P 5-Phe-7,9-trp-11-leu-substance P 5-Phenylalanyl-7,9-tryptophyl-11-leucine-substance P 96736-12-8 AntD Apttl-SP D-Arg(10)-D-phe(5)-D-trp(7,9)-leu(11)-SP L-756,867 Substance P, 1-D-arginine-5-D-phenylalanine-7-D-tryptophan-9-D-tryptophan-11-L-leucinamide- Substance P, arg(1)-phe(5)-trp(7,9)-leu(11)- Substance P, arginyl(1)-phenylalanyl(5)-tryptophyl(7,9)-leucyl(11)- Substance P, phe(5)-trp(7,9)-leu(11)- Substance P, phenylalanyl(5)-tryptophyl(7,9)-leucine(11)- Substance P-pttl

pdb file: 702774.pdb
sdf file: 702774.sdf
directory: 702774

96927-63-8 Fgf (1-10) Fibroblast growth factor (1-10) L-Tyrosine, N-(N-(N-(N-(N-(N-(1-(N-(N-L-prolyl-L-alanyl)-L-leucyl)-L-prolyl)-L-alpha-glutamyl)-L-alpha-aspartyl)glycyl)glycyl)-L-seryl)-

pdb file: 702857.pdb
sdf file: 702857.sdf
directory: 702857

97055-09-9 Icaria chemotactic peptide Ile-val-pro-phe-leu-gly-pro-leu-leu-gly-leu-leu-thr-NH2 L-Threoninamide, L-isoleucyl-L-valyl-L-prolyl-L-phenylalanyl-L-leucylglycyl-L-prolyl-L-leucyl-L-leucylglycyl-L-leucyl-L-leucyl-

pdb file: 702878.pdb
sdf file: 702878.sdf
directory: 702878

97145-43-2 Ac-Pro-phe-arg-ser-val-gln-NH2 KKI 5 KKI-5 L-Glutamamide, 1-acetyl-L-prolyl-L-phenylalanyl-L-arginyl-L-seryl-L-valyl-

pdb file: 702895.pdb
sdf file: 702895.sdf
directory: 702895

136577-07-6 Alanyl-lactate Alanyllactate D-Alanine, 1-carboxyethyl ester, (R)- D-Alanyl-D-lactate

pdb file: 702946.pdb
sdf file: 702946.sdf
directory: 702946

137730-92-8 Gly-ala-ile Glycyl-alanyl-isoleucine L-Isoleucine, N-(N-glycyl-L-alanyl)-

pdb file: 702979.pdb
sdf file: 702979.sdf
directory: 702979

97207-35-7 Boc-phe-phe-gly-nhoh tert-Butyloxycarbonyl-phenylalanyl-phenylalanyl-glycine hydroxylamine

pdb file: 702989.pdb
sdf file: 702989.sdf
directory: 702989

3-Iododesaminotyrosyl-phenylalanyl-phenylalanyl-glycine hydroxamic acid 97207-36-8 Glycinamide, N-(3-(4-hydroxy-3-iodophenyl)-1-oxopropyl)-L-phenylalanyl-L-phenylalanyl-N-hydroxy- ID-Tyr-phe-phe-gly-nhoh Ibh-phe-phe-gly-nhoh Ippgnhoh

pdb file: 702990.pdb
sdf file: 702990.sdf
directory: 702990

97207-37-9 Ibh-substance P hexapeptide L-Methioninamide, N2-(3-(4-hydroxy-3-iodophenyl)-1-oxopropyl)-L-glutaminyl-L-phenylalanyl-L-phenylalanylglycyl-L-leucyl- N(alpha)-(3-Iododesaminotyrosyl)-substance P (6-11) SP(6-11)-Ibh Substance P (6-11), N(alpha)-(3-iododesaminotyrosyl)-

pdb file: 702991.pdb
sdf file: 702991.sdf
directory: 702991

1-(3-(3-(Aminoiminomethyl)phenyl)-2-(((4-methylphenyl)sulfonyl)amino)-1-oxopropyl)piperidine 3-Tapap 73438-63-8 80457-09-6 N(alpha)-(4-Toluenesulfonyl)-3-amidinophenylalanylpiperidine N(alpha)-Tosyl-(3-amidinophenyl)alanine piperidide Nalpha-Tosyl-(3-amidinophenyl)alanine piperidide Piperidine, 1-(3-(3-(aminoiminomethyl)phenyl)-2-(((4-methylphenyl)sulfonyl)amino)-1-oxopropyl)- TAPAP

pdb file: 703078.pdb
sdf file: 703078.sdf
directory: 703078

73554-90-2 Boc-phe-ser-arg-mca L-Argininamide, N-((1,1-dimethylethoxy)carbonyl)-L-phenylalanyl-L-seryl-N-(4-methyl-2-oxo-2H-1-benzopyran-7-yl)- t-Butyloxycarbonyl-phe-ser-arg-mca tertiary-Butyloxycarbonyl-phenylalanyl-seryl-arginyl-4-methylcoumarin-7-amide

pdb file: 703091.pdb
sdf file: 703091.sdf
directory: 703091

74392-49-7 D-Phe-phe-arg-CH2Cl D-Phe-phe-arg-chloromethyl ketone Dppacmk FFRCK L-Phenylalaninamide, D-phenylalanyl-N-(4-((aminoiminomethyl)amino)-1-(chloroacetyl)butyl)-, (S)- Phe-phe-arg-CH2-Cl Phe-phe-arg-CK Phe-phe-arg-chloromethyl ketone Phenylalanyl-phenylalanyl-arginine chloromethyl ketone

pdb file: 703189.pdb
sdf file: 703189.sdf
directory: 703189

6,7-Arg-8-val-9-gly-10-arg-11-pro-12-glu-met-enkephalin 75513-71-2 Bam 12P Bam-12P Enkephalin-met, arg(6,7)-val(8)-gly(9)-arg(10)-pro(11)-glu(12)- Enkephalin-met, arginyl(6,7)-valyl(8)-glycyl(9)-arginyl(10)-prolyl(11)-glu(12)- L-Glutamic acid, N-(1-(N(2)-(N-(N-(N(2)-(N(2)-(N-(N-(N-(N-L-tyrosylglycyl)glycyl)-L-phenylalanyl)-L-methionyl)-L-arginyl)-L-arginyl)-L-valyl)glycyl)-L-arginyl)-L-prolyl)- Met-enkephalin, arg(6,7)-val(8)-gly(9)-arg(10)-pro(11)-glu(12)- Methionine-enkephalin, arg(6,7)-val(8)-gly(9)-arg(10)-pro(11)-glu(12)-

pdb file: 703231.pdb
sdf file: 703231.sdf
directory: 703231

97280-40-5 Ddp-ala-pro L-Proline, 1-(N-(diphenoxyphosphinyl)-L-alanyl)-, compd. with N-cyclohexylcyclohexanamine (1:1) N(alpha)-(Diphenoxyphosphoryl)alanylproline N(alpha)-Diphenoxyphosphoryl-L-alanyl-L-proline

pdb file: 703349.pdb
sdf file: 703349.sdf
directory: 703349

97280-42-7 Bnp-ala-pro L-Proline, 1-(N-(bis(4-nitrophenoxy)phosphinyl)-L-alanyl)-, 1,1-dimethylethyl ester N(alpha)-(Bis(4-nitrophenoxy)phosphoryl)-L-alanyl-L-proline N(alpha)-(Bis(4-nitrophenoxy)phosphoryl)alanylproline

pdb file: 703350.pdb
sdf file: 703350.sdf
directory: 703350

97280-48-3 L-Proline, 1-(N-(phenoxy(2-phenylethyl)phosphinyl)-L-alanyl)- N(alpha)-((2-Phenylethyl)phenoxyphosphoryl)-L-alanyl-L-proline N(alpha)-((2-Phenylethyl)phenoxyphosphoryl)alanylproline Ppp-ala-pro

pdb file: 703351.pdb
sdf file: 703351.sdf
directory: 703351

97453-39-9 L-Isoleucine, N-(1-(N-(1-(N-(1-L-tyrosyl-L-prolyl)glycyl)-L-prolyl)-L-phenylalanyl)-L-prolyl)- Tyr-pro-gly-pro-phe-pro-ile Tyrosyl-prolyl-glycyl-prolyl-phenylalanyl-prolyl-isoleucine beta-Casomorphin I

pdb file: 703366.pdb
sdf file: 703366.sdf
directory: 703366

97483-83-5 L-leucinamide, L-tyrosyl-L-valyl-L-arginylglycyl-L-methionyl-L-alanyl-L-seryl-L-lysyl-L-alanylglycyl-L-alanyl-L-isoleucyl-L-alanylglycyl-L-lysyl-L-isoleucyl-L-alanyl-L-lysyl-L-valyl-L-alanyl-L-leucyl-L-lysyl-L-alanyl- PYLA Peptide tyrosine leucine amide Pyl(a)

pdb file: 703387.pdb
sdf file: 703387.sdf
directory: 703387

143728-97-6 Cochinmicin I Glycine, D-2-(3,5-dihydroxyphenyl)-N-(D-2-(3,5-dihydroxyphenyl)-N-(N-(N-(N-(N-(2,3,4,5-tetrahydroprolyl)-L-phenylalanyl)-D-allothreonyl)-D-phenylalanyl)-D-alanyl)glycyl)-, xi-lactone

pdb file: 703452.pdb
sdf file: 703452.sdf
directory: 703452

143728-98-7 Cochinmicin II Glycine, N-(N-(N-(N-(N-(N-(5-chloro-2,3,4,5-tetradehydroprolyl)-L-phenylalanyl)-D-allothreonyl)-D-phenylalanyl)-D-alanyl)-D-2-(3,5-dihydroxyphenyl)glycyl)-L-2-(3,5-dihydroxyphenyl)-, xi-lactone

pdb file: 703453.pdb
sdf file: 703453.sdf
directory: 703453

143728-99-8 Cochinmicin III Glycine, N-(N-(N-(N-(N-(N-(5-chloro-2,3,4,5-tetradehydroprolyl)-L-phenylalanyl)-D-allothreonyl)-D-phenylalanyl)-D-alanyl)-D-2-(3,5-dihydroxyphenyl)glycyl)-D-2-(3,5-dihydroxyphenyl)-, xi-lactone

pdb file: 703454.pdb
sdf file: 703454.sdf
directory: 703454

97559-39-2 L-Methioninamide, L-alpha-aspartyl-L-phenylalanyl-L-valyglycyl-L-leucyl- Neurokinin B (4-10) Nkb-(4-10)

pdb file: 703464.pdb
sdf file: 703464.sdf
directory: 703464

55-Tyr-pth (42-55) 55-Tyrosyl-parathyroid hormone (42-55) 97613-65-5 Hpth (42-55), 55-tyr- L-Tyrosine, L-alanyl-L-prolyl-L-arginyl-L-alpha-aspartyl-L-alanylglycyl-L-seryl-L-glutaminyl-L-arginyl-L-prolyl-L-arginyl-L-lysyl-L-lysyl-, (+-)- Parathyroid hormone (42-55), 55-tyr-

pdb file: 703472.pdb
sdf file: 703472.sdf
directory: 703472

68-Tyr-pth (43-68) 68-Tyrosyl-parathyroid hormone (43-68) 97642-75-6 Hpth (43-68), 68-tyr- L-Tyrosine, L-prolyl-L-arginyl-L-alpha-aspartyl-L-alanylglycyl-L-seryl-L-glutaminyl-L-arginyl-L-prolyl-L-arginyl-L-lysyl-L-lysyl-L-alpha-glutamyl-L-alpha-aspartyl-L-asparaginyl-L-valyl-L-leucyl-L-valyl-L-.a(+-)- Parathyroid hormone (43-68), 68-tyr-

pdb file: 703478.pdb
sdf file: 703478.sdf
directory: 703478

97730-74-0 Cytochrophin-4 L-Threonine, N-(N-(1-L-throsyl-L-prolyl)-L-phenylalanyl)- Tyr-pro-phe-thr Tyrosyl-prolyl-phenylalanyl-threonine

pdb file: 703498.pdb
sdf file: 703498.sdf
directory: 703498

(2S,3R)-3,7-Diamino-2-hydroxyheptanoyl-alanyl-proline 144732-36-5 3,7-Diamino-2-hydroxyheptanoyl-alanyl-proline Dahha-ala-pro-OH L-Proline, 1-(N-(3,7-diamino-2-hydroxy-1-oxoheptyl)-L-alanyl)-, (S-(R*,S*))-

pdb file: 703529.pdb
sdf file: 703529.sdf
directory: 703529

145196-52-7 Ac-Pro-ala-ala-nhme Acetylprolyl-alanyl-alanine-N-methylamide L-Alaninamide, l-acetyl-L-prolyl-D-alanyl-N-methyl- N-Acetyl-L-prolyl-D-alanyl-L-alanine-N'-methylamide

pdb file: 703544.pdb
sdf file: 703544.sdf
directory: 703544

2-Met-4-(4-nitro)-phe-5-pronh2-enkephalin 98311-64-9 BW 942C BW-942-C Enkephalin, met(2)-4-nitro-phe(4)-pronh2(5)- Enkephalin, methionyl(2)-4-nitrophenylalanyl(4)-prolinamide(5)- L-Prolinamide, L-tyrosyl-gamma-(methylsulfinyl)-D-alpha-aminobutyrylglycyl-4-nitro-L-phenylalanyl-, monoacetate (salt) Tyr-met-O-gly-4-No2-phe-pro-NH2 Tyrosyl-methionyl-O-glycyl-para-nitro-phenylalanyl-prolinamide

pdb file: 703585.pdb
sdf file: 703585.sdf
directory: 703585

98495-35-3 L-Phenylalaninamide, 5-oxo-L-prolyl-L-alpha-aspartyl-L-prolyl-L-phenylalanyl-L-leucyl-L-arginyl- Pglu-asp-pro-phe-leu-arg-phenh2 Pqdpflrfamide Pyroglutamyl-aspartyl-prolyl-phenylalanyl-leucyl-arginyl-phenylalaninamide

pdb file: 703624.pdb
sdf file: 703624.sdf
directory: 703624

97992-01-3 TA-delta-Phe-gnh2 Tyr-ala-delta-phe-glynh2 Tyrosyl-alanyl-delta-phenylalanyl-glycinamide

pdb file: 703661.pdb
sdf file: 703661.sdf
directory: 703661

98056-23-6 Glycine, N-(N-(1-(ethoxycarbonyl)-3-phenylpropyl)-L-alanyl)-N-1-pyrrolidinyl-, (S)- N-(N-(1-(Ethoxycarbonyl)-3-phenylpropyl)alanyl)-N-(1-pyrrolidinyl)glycine Rev 6207 Rev-6207

pdb file: 703734.pdb
sdf file: 703734.sdf
directory: 703734

98092-14-9 Isovaleryl-phenylalanyl-norleucyl-statine-alanyl-hydroxystatine Iva-phe-nle-sta-ala-sta-OH L-Alaninamide, N-(3-methyl-1-oxobutyl)-L-phenylalanyl-L-norleucyl-(3S,4S)-4-amino-3-hydroxy-6-methylheptanoyl-N-((1S)-1-((1S)-2-carboxy-1-hydroxyethyl)-3-methylbutyl)- L-Norleucinamide, N-(3-methyl-1-oxobutyl)-L-phenylalanyl-N-(4-((2-((1-(2-carboxy-1-hydroxyethyl)-3-methylbutyl)amino)-1-methyl-2-oxoethyl)amino)-2-hydroxy-1-(2-methylpropyl)-4-oxobutyl)-, (1S-(1R*,2R*,4(R*(R*(R*)))))- Pepstatin A, 1-(N-(3-methyl-1-oxobutyl)-L-phenylalanine)-2-L-norleucine- SR 42128 SR-42128

pdb file: 703751.pdb
sdf file: 703751.sdf
directory: 703751

76079-03-3 FA-Ala-lys Furylacryloyl-ala-lys Furylacryloyl-alanyl-lysine Furylacryloylalanyllysine L-Lysine, N(2)-(N-(3-(2-furanyl)-1-oxo-2-propenyl)-L-alanyl)-

pdb file: 703784.pdb
sdf file: 703784.sdf
directory: 703784

6-Arg-met-enkephalin 76310-14-0 Enkephalin-met, arg(6)- Enkephalin-met, arginine(6)- L-Arginine, N2-(N-(N-(N-(N-L-tyrosylglycyl)glycyl)-L-phenylalanyl)-L-methionyl)- Met-enk-A Met-enkephalin, arg(6)- Methionine-enkephalin, arg(6)-

pdb file: 703793.pdb
sdf file: 703793.sdf
directory: 703793

2-Ala-4-(4-azido-phe)-met-enkephalin 98749-66-7 Enkephalin-met, ala(2)-4-azido-phe(4)- Enkephalin-met, alanyl(2)-4-azidophenylalanine(4)- MEAZP Met-enkephalin, ala(2)-4-azido-phe(4)- Methionine-enkephalin, ala(2)-4-azido-phe(4)-

pdb file: 703810.pdb
sdf file: 703810.sdf
directory: 703810

6-Pglu-8-phe-psi-(methyleneoxy)-9-gly-substance P (6-11) 98900-29-9 L-Methioninamide, N-((2-((N-(5-oxo-L-prolyl)-L-phenylalanyl)amino)-3-phenylpropoxy)acetyl)-L-leucyl-, (S)- Pglu-phe-CH2O-gly-SP (6-11) Substance P (6-11), pglu(6)-phe(8)-psi-(methyleneoxy)-gly(9)- Substance P (6-11), pyroglutamyl(6)-phenylalanyl(8)-psi-(methyleneoxy)-glycine(9)-

pdb file: 703849.pdb
sdf file: 703849.sdf
directory: 703849

7-((N-Tosylphenylalanyl)amino)-4-chloro-3-methoxyisocoumarin 99033-29-1 Tpacmi

pdb file: 703866.pdb
sdf file: 703866.sdf
directory: 703866

99278-03-2 Gsk peptide L-Alanine, L-prolyl-L-leucyl-L-arginyl-L-arginyl-L-threonyl-L-leucyl-L-seryl-L-valyl-L-alanyl- Pro-leu-arg-arg-thr-leu-ser-val-ala-ala

pdb file: 703930.pdb
sdf file: 703930.sdf
directory: 703930

99332-97-5 N-4-Azido-2-nitrophenyl-beta-alanyl-gamma-tocopherol Napa-gamma-tocopherol

pdb file: 703961.pdb
sdf file: 703961.sdf
directory: 703961

3-O-(Mdp-ala)cholesterol 99518-28-2 L-Alanine, N-(N2-(N-(N-acetylmuramoyl)-L-alanyl)-D-alpha-glutaminyl)-, (3beta)-cholest-5-en-3-yl ester Mdp-alanyl-cholesterol Mtp-alanyl-3-O-cholesterol Mtp-chol N-Acetylmuramyl-alanyl-isoglutamine-alanyl-cholesterol

pdb file: 703999.pdb
sdf file: 703999.sdf
directory: 703999

99534-03-9 IP 20 IP-20 L-Aspartic acid, L-threonyl-L-threonyl-L-tyrosyl-L-alanyl-L-alpha-aspartyl-L-phenylalnyl-L-isoleucyl-L-alanyl-L-serylglycyl-L-arginyl-L-threonylglycyl-L-arginyl-L-arginyl-L-asparaginyl-L-alanyl-L-isoleucyl-L-histidyl- Peptide inhibitor IP-20 Sip 20 Thr-thr-tyr-ala-asp-phe-ile-ala-ser-gly-arg-thr-gly-arg-arg-asn-ala-ala-his-asp

pdb file: 704003.pdb
sdf file: 704003.sdf
directory: 704003

(H-Tyr-lys-gly-phe-glu-NH2)2 (H-Tyrosyl-lysyl-glycyl-phenylalanyl-glutamamide)2 99571-07-0 Cyclic dimer tlgpg

pdb file: 704016.pdb
sdf file: 704016.sdf
directory: 704016

99588-52-0 A-18-Famide A18Fa A18Famide Ala-gly-glu-gly-leu-ser-ser-pro-phe-trp-ser-leu-ala-ala-pro-gln-arg-phe-NH2 L-Phenylalaninamide, L-alanylglycyl-L-alpha-glutamylglycyl-L-leucyl-L-seryl-l-seryl-L-prolyl-L-phenylalanyl-L-tryptophyl-L-seryl-L-leucyl-L-alanyl-L-alanyl-L-prolyl-L-glutaminyl-L-arginyl-

pdb file: 704017.pdb
sdf file: 704017.sdf
directory: 704017

99660-13-6 IM 4-28 L-Threoninamide, D-phenylalanyl-L-cysteinyl-L-tyrosyl-D-tryptophyl-L-lysyl-L-valyl-L-cysteinyl-, cyclic (2-7)-disulfide P-Cttlvc-T Phe-cyclo(cys-tyr-trp-lys-val-cys)thr-NH2 Phenylalanyl-cyclo(cysteinyl-tyrosyl-tryptophyl-lysyl-valyl-cysteinyl)threoninamide RC 121 RC-121

pdb file: 704034.pdb
sdf file: 704034.sdf
directory: 704034

99685-66-2 L-Threoninamide, D-phenylalanyl-L-cycteingyl-L-phenylalanyl-D-tryptophyl-L-lysyl-L-threonyl-L-cysteinyl-, cyclic (2-7)-disulfide Phe-cyclo(cys-phe-trp-lys-thr-cys)-thr-NH2 Somatostatin RC 102 Somatostatin-RC-102

pdb file: 704044.pdb
sdf file: 704044.sdf
directory: 704044

99764-53-1 Cyclo(lys-tyr-gly-gly-phe-leu) Cyclo(lysyl-tyrosyl-glycyl-glycyl-phenylalanyl-leucyl)

pdb file: 704063.pdb
sdf file: 704063.sdf
directory: 704063

99880-61-2 Fmlp-otbu N-Formylmethionyl-leucyl-phenylalanyl tert-butyl ester

pdb file: 704083.pdb
sdf file: 704083.sdf
directory: 704083

100007-40-7 Fnle-leu-phe-tyr N-Formylnorleucyl-leucyl-phenylalanyl-tyrosine

pdb file: 704102.pdb
sdf file: 704102.sdf
directory: 704102

100304-60-7 Dermorphin tetrapeptide, tyr-arg-phe-gly-NH2 Glycinamide, L-tyrosyl-D-arginyl-L-phenylalanyl- Tyr-arg-phe-gly-NH2 Tyrosyl-arginyl-phenylalanyl-glycinamide

pdb file: 704152.pdb
sdf file: 704152.sdf
directory: 704152

100994-43-2 t-Boc-val-(3-hydroxy-4-amino-5-(2-naphthyl)pentanoyl)-ala-isoamylamide t-Boc-vhanpa tert-Boc-valyl-(3-hydroxy-4-amino-5-(2-naphthyl)pentanoyl)-alanylisoamylamide

pdb file: 704369.pdb
sdf file: 704369.sdf
directory: 704369

101043-35-0 Cyanoginosin LA, 3-L-tyrosine-5-L-methionine- Cyclo(ala-tyr-Me-asp-met-3-amino-9-methoxy-2,6,8-trimethyl-10-phenyldeca-4,6-dienoic acid-glu-methyldehydeoalanyl) Cyclo(ala-tyr-Me-asp-met-adda-glu-medha) Microcystin YM

pdb file: 704394.pdb
sdf file: 704394.sdf
directory: 704394

101380-54-5 Bovine parathyroid hormone (7-34) L-Phenylalanine, L-phenylalanyl-L-methionyl-L-histidyl-L-asparaginyl-L-leucylglycyl-L-lysyl-L-histidyl-L-leucyl-L-seryl-L-seryl-L-methionyl-L-alpha-glutamyl-L-arginyl-L-valyl-L-alpha-glutamyl-L-tryptophyl-L-leucyl-L-arginyl-L-valyl-L-histidyl-L-asparaginyl- PTH (7-34) Parathyroid hormone (7-34) bPTH (7-34)

pdb file: 704439.pdb
sdf file: 704439.sdf
directory: 704439

101554-61-4 L-Leucine, N-(N-(N2-(1-(N-(1-(N-(1-(N-(1-L-tyrosyl-L-prolyl)-L-phenylalanyl)-L-prolyl)glycyl)-L-prolyl)-L-isoleucyl)-L-prolyl)-L-asparginyl)-L-seryl)- Tyr-pro-phe-pro-gly-pro-ile-pro-asn-ser-leu Tyrosyl-prolyl-phenylalanyl-prolyl-glycyl-prolyl-isoleucyl-prolyl-asparaginyl-seryl-leucine beta-Casomorphin 11

pdb file: 704568.pdb
sdf file: 704568.sdf
directory: 704568

101820-46-6 Glycine, N-(N-(1-(ethoxycarbonyl)-3-phenylpropyl)-L-alanyl)-N-(phenylmethyl)-, (S)- N-(N-(1 (Ethoxycarbonyl)-3-phenylpropyl)alanyl)-N-(phenylmethyl)glycine Rev 5975 Rev-5975

pdb file: 704610.pdb
sdf file: 704610.sdf
directory: 704610

101848-26-4 Glycine, N-(N-(N-(N-(N-(N-(N-L-leucyl-L-phenylalanyl)-L-valyl)-L-valyl)-L-threonyl)-L-leucyl)-L-valyl)- Leu-phe-val-val-thr-leu-val-gly-OH Leucyl-phenylalanyl-valyl-valyl-threonyl-leucyl-valyl-glycine N-(N-(N-(N-(N-(N-(N-L-Leucyl-L-phenylalanyl)-L-valyl)-L-valyl)-L-threonyl)-L-leucyl)-L-valyl)glycine Sex pheromone inhibitor iad1

pdb file: 704614.pdb
sdf file: 704614.sdf
directory: 704614

(4-24)-Ply(a) 102068-15-5 Gla peptide L-Leucinamide, glycyl-L-methionyl-L-alanyl-L-seryl-L-lysyl-L-alanylglylcyl-L-alanyl-L-isoleucyl-L-alanylglycyl-L-lysyl-L-isoleucyl-L-alanyl-L-lysyl-L-valyl-L-alanyl-L-leucyl-L-lysyl-L-alanyl- PGLA Peptide-gly-leu-amide Pgl(a) Pyl(a), 4-24-

pdb file: 704642.pdb
sdf file: 704642.sdf
directory: 704642

102129-66-8 AAPCK Ala-ala-phe-chloromethyl ketone Alanyl-alanyl-phenylalanine chloromethyl ketone

pdb file: 704678.pdb
sdf file: 704678.sdf
directory: 704678

102146-01-0 9-Des-gly-(2-phe-8-orn)-vasopressin 9-Desglycyl-(2-phenylalanyl-8-ornithine)-vasopressin Vasopressin, 9-des-gly-(2-phe-8-orn)- Vasopressin, 9-desglycyl-(2-phenylalanyl-8-ornithine)-

pdb file: 704683.pdb
sdf file: 704683.sdf
directory: 704683

102334-63-4 Cyclo(H-glu-phe-gly-leu-met-NH(CH2)3-NH-)-substance P SP C(Gppglmn) Substance P, cyclo(H-glu-phe-phe-gly-leu-met-NH(CH2)3-NH-) Substance P, cyclo(H-glutamyl-phenylalanyl-phenylalanyl-glycyl-leucyl-methionine propylene diamine)

pdb file: 704700.pdb
sdf file: 704700.sdf
directory: 704700

102579-48-6 Gly-phe-gly-Sc Glycyl-phenylalanyl-glycine-semicarbazone Glycyl-phenylalanyl-glycylsemicarbazone

pdb file: 704737.pdb
sdf file: 704737.sdf
directory: 704737

102582-51-4 Phe-3-S-phe Phenylalanyl-3-thiaphenylalanine

pdb file: 704740.pdb
sdf file: 704740.sdf
directory: 704740

102979-72-6 6-Orn-substance P (6-11) L-Methioninamide, L-ornithyl-L-phenylalanyl-L-phenylalanylglycyl-L-leucyl- L-Ornithyl-L-phenylalanyl-L-phenylalanylglycyl-L-leucyl-L-methioninamide Substance P (6-11), orn(6)- Substance P (6-11), ornithine(6)-

pdb file: 704834.pdb
sdf file: 704834.sdf
directory: 704834

1-((1,1-Dimethylethoxy)carbonyl)-L-prolyl-D-alanyl-N-methyl-L-alaninamide 103137-93-5 BPAAM L-Alaninamide, 1-((1,1-dimethylethoxy)carbonyl)-L-prolyl-D-alanyl-N-methyl- N-t-Boc-pro-ala-ala-nhch3 N-tert-Butyloxycarbonyl-prolyl-alanyl-alanyl-methylamide

pdb file: 704843.pdb
sdf file: 704843.sdf
directory: 704843

103221-88-1 BW A-575C BW B385C BW-A 575C L-Proline, 1-(N-(1-carboxy-5-(((4-(2-hydroxy-3-((1-methylethyl)amino)propoxy)-1H-indol-2-yl)carbonyl)amino)pentyl)-DL-alanyl)- N-(1-Carboxy-5-(4-(2-hydroxy-3-isopropylaminopropoxy)-1H-indole-2-carboxamido)pentyl)alanylproline N-(1-Carboxy-5-(4-(3-isopropylamino-2-hydroxypropoxy)indole-2-carboxamido)pentyl)-alanyl-proline

pdb file: 704847.pdb
sdf file: 704847.sdf
directory: 704847

(S-(R*,R*))-N-(3-Hydroxy-6-methyl-1-oxo-4-((N-(N-(1-(N-L-prolyl-L-histidyl)-L-prolyl)-L-phenylalanyl)-L-histidyl)amino)heptyl)-L-isoleucyl-L-phenylalaninamide 103122-78-7 L-Phenylalaninamide, N-(3-hydroxy-6-methyl-1-oxo-4-((N-(N-(1-(N-L-prolyl-L-histidyl)-L-prolyl)-L-phenylalanyl)-L-histidyl)amino)heptyl)-L-isoleucyl-, (S-(R*,R*))- Pro-his-pro-phe-his-statine-ile-phe-NH2 Prolyl-histidyl-prolyl-phenylalanyl-histidyl-statine-isoleucyl-phenylalaninamide R-PEP 27 Renin inhibitory peptide, R-pep-27

pdb file: 704869.pdb
sdf file: 704869.sdf
directory: 704869

103137-94-6 BPGAM N-t-Boc-pro-gly-ala-nhch3 N-tert-Butyloxycarbonyl-prolyl-glycyl-alanyl-methylamide

pdb file: 704875.pdb
sdf file: 704875.sdf
directory: 704875

103237-51-0 Acetylphenylalanyl-cysteinyl-tyrosyl-tryptophyl-lysyl-valyl-cysteinyl-threoninamide L-Threoninamide, N-acetyl-D-phenylalanyl-L-cysteinyl-L-tyrosyl-D-tryptophyl-L-lysyl-L-valyl-L-cysteinyl-, cyclic (2-7)-disulfide RC 161 RC-161

pdb file: 704899.pdb
sdf file: 704899.sdf
directory: 704899

3,5-Diiodo-N-phe-tyr 80434-83-9 L-Tyrosine, 3,5-diiodo-N-L-phenylalanyl- Melanotropin potentiating factor Msh potentiating factor PADIT Phe-diiodo-tyr Phenylalanyl-diiodotyrosine beta Lipotropin (88-91) beta-Lph (88-91)

pdb file: 704969.pdb
sdf file: 704969.sdf
directory: 704969

1-Arginyl-2-hydroxyprolyl-5-(2-thienyl)alanyl-7-phenylalanyl-8-(2-thienyl)alanyl-bradykinin 103412-36-8 2-Hyp-5,8-(thi-ala)-7-phe-bradykinin Ahtp-BK Arg-hyp-pro-gly-thi-ser-phe-thi-arg Arginyl-hydroxyprolyl-prolyl-glycyl-(2-thienyl)alanyl-seryl-phenylalanyl-2-(thienyl)alanyl-arginine Bradykinin, arg-hyp(2)-(thi-ala)(5,8)-phe(7)- Bradykinin, hydroxyprolyl(2)-thienylalanyl(5,8)-phenylalanine(7)- Hoe k86-4321 Hoe-k86-4321 L-Arginine, N2-(N-(N-(N-(N-(N-(1-(1-(N2-D-arginyl-L-arginyl)-trans-4-hydroxy-L-prolyl)-L-prolyl)glycyl)-3-(2-thienyl)-L-alanyl)-L-seryl)-D-phenylalanyl)-3-(2-thienyl)-L-alanyl)-

pdb file: 704976.pdb
sdf file: 704976.sdf
directory: 704976

103412-37-9 B 4148 B-4148 Bradykinin, lys-lys-(hyp(2)-thi(5,8)-phe(7))- Bradykinin, lysyl-lysyl-(hydroxyprolyl(2)-thienyl(5,8)-phenylalanine(7))- L-Arginine, N2-(N-(N-(N-(N-(N-(1-(trans-4-hydroxy-1-(N2-(N2-L-lysyl-L-lysyl)-L-arginyl)-L-prolyl)-L-prolyl)glycyl)-3-(2-thienyl)-L-alanyl)-L-seryl)-D-phenylalanyl)-3-(2-thienyl)-L-alanyl)- Lys-lys-(2-hyp-5,8-thi-7-phe)-bradykinin

pdb file: 704977.pdb
sdf file: 704977.sdf
directory: 704977

103412-40-4 B 4310 B-4310 Bradykinin, lys-lys-3-hyp-5,8-thi-7-phe- Bradykinin, lys-lys-hyp(3)-(thi-ala)(5,8)-phe(7)- Bradykinin, lysyl-lysyl-hydroxyproly(3)-(thienylalanyl)(5,8)-phenylalanyl(7)- L-Arginine, N2-(N-(N-(N-(N-(N-(trans-4-hydroxy-1-(1-(N2-(N2-L-lysyl-L-lysyl)-L-arginyl)-L-prolyl)-L-prolyl)glycyl)-3-(2-thienyl)-L-alanyl)-L-seryl)-D-phenylalanyl)-3-(2-thienyl)-L-alanyl)- Lys-lys-3-hyp-5,8-(thi-ala)-7-phe- Lysyl-lysyl-3-(hydroxyprolyl)-5,8-thienyl-7-phenylalanine-bradykinin

pdb file: 704978.pdb
sdf file: 704978.sdf
directory: 704978

103433-42-7 Arg-pro-hyp-gly-thi-ser-phe-thi-arg tfa Arg-pro-hyp-gly-thi-ser-phe-thi-arg-OH Arginyl-prolyl-4-hydroxyprolyl-glycyl-beta-(2-thienyl)alanyl-seryl-phenylalanyl-beta-(2-thienyl)alanyl-arginine trifluoroacetic acid B 4146 B 4147 B-4146 B-4147 B4146 B4147 Bradykinin, 3-(trans-4-hydroxy-L-proline)-5-(3-(2-thienyl)-L-alanine)-7-D-phenylalanine-8-(3-(2-thienyl)-L-alanine)-

pdb file: 704987.pdb
sdf file: 704987.sdf
directory: 704987

103527-34-0 Gfsamide Gly-phe-ser-NH2 Glycyl-phenylalanyl-serinamide

pdb file: 705005.pdb
sdf file: 705005.sdf
directory: 705005

1-N-Ac-1,2-(4-Cl-Phe)-3-trp-6-arg-10-alanh2-LHRH 81608-49-3 D-Alaninamide, N-acetyl-4-chloro-D-phenylalanyl-4-chloro-D-phenylalanyl-D-tryptophyl-L-seryl-L-tyrosyl-D-arginyl-L-leucyl-L-arginyl-L-prolyl- GNRH, N-Ac-(4-Cl-phe)(1,2)-trp(3)-arg(6)-alanh2(10)- LHRH, N-ac-(4-Cl-Phe)(1,2)-trp(3)-arg(6)-alanh2(10)- LHRH-N-Acetyl-4-chlorophenylalanyl(1,2)-tryptophyl(3)-arginyl(6)-alaninamide Napt-taa

pdb file: 705064.pdb
sdf file: 705064.sdf
directory: 705064

104234-99-3 Fmlpl-sasd Formyl-met-leu-phe-sasd-lys L-Lysine, N6-(3-((2-((4-azido-2-hydroxybenzoyl)amino)ethyl)dithio)-1-oxopropyl)-N2-(N-(N-(N-formyl-L-methionyl)-L-leucyl)-L-phenylalanyl)- N-Formyl-methionylleucyl-phenylalanyl-N(epsilon)-(2-(4-azidosalicylamido)ethyl-1,3'-dithiopropionyl)lysine N6-(3-((2-((4-Azido-2-hydroxybenzoyl)amino)ethyl)dithio)-1-oxopropyl)-N2-(N-(N-(N-formyl-L-methionyl)-L-leucyl)-L-phenylalanyl)-L-lysine

pdb file: 705118.pdb
sdf file: 705118.sdf
directory: 705118

104264-92-8 9-((2-Hydroxy-4-(hydroxymethyl)-3-((4-methoxyphenylalanyl)amino)cyclopentyl))-6-(dimethylamino)purine Benzenepropanamide, alpha-amino-N-(3-(6-(dimethylamino)-9H-purin-9-yl)-2-hydroxy-5-(hydroxymethyl)cyclopentyl)-4-methoxy-, (1S-(1alpha(R*),2alpha,3beta,5beta))- Carbocyclic puromycin Puromycin, carbocyclic alpha-Amino-N-(3-(6-(dimethylamino)-9H-purin-9-yl)-2-hydroxy-5-(hydroxymethyl)cyclopentyl)-4-methoxybenzenepropanamide (1S-(1alpha(R*),2alpha,3beta,5beta))-

pdb file: 705121.pdb
sdf file: 705121.sdf
directory: 705121

104499-97-0 8-Mephe-5,6-asp-substance P (5-11) Amino-senktide L-Methioninamide, L-alpha-aspartyl-L-alpha-aspartyl-L-phenylalanyl-N-methyl-L-phenylalanylglycyl-L-leucyl- NH2-Senktide Substance P (5-11), asp(5,6)-mephe(8)- Substance P (5-11), asparaginyl(5,6)-methylphenylalanine(8)-

pdb file: 705186.pdb
sdf file: 705186.sdf
directory: 705186

104840-35-9 Bagougeramine A beta-D-Glucopyranuronamide, 4-((3-((aminoiminomethyl)amino)-N-(N-methylglycyl)-D-alanyl)amino)-1-(4-amino-2-oxo-1(2H)-pyrimidinyl)-1,4-dideoxy-

pdb file: 705280.pdb
sdf file: 705280.sdf
directory: 705280

104973-52-6 AK-Me6 D-Phenylalanine, N-acetyl-, 4-methoxy-1-(2-methyloxiranyl)-4-oxo-2-butenyl ester, (R-(R*,R*-(E)))- Methyl 4-(N-acetylphenylalanyl)oxy-5,6-epoxy-5-methylhex-2-enoate

pdb file: 705301.pdb
sdf file: 705301.sdf
directory: 705301

85613-77-0 L-Phenylalaninamide, N-(3-carboxy-1-oxopropyl)-L-alanyl-L-alanyl-N-(4-methoxy-2-naphthalenyl)- N-(3-Carboxy-1-oxopropyl)-L-alanyl-L-alanyl-N-(4-methoxy-2-naphthalenyl)-L-phenylalaninamide Suc-ala-ala-phe-mna Succinyl-alanyl-alanyl-phenylalanyl-4-methoxy-2-naphthylamide

pdb file: 705309.pdb
sdf file: 705309.sdf
directory: 705309

105027-75-6 Diallyl-tyr-aib-aib-phe-OH L-Phenylalanine, N-(N-(N-(N,N-di-2-propenyl-L-tyrosyl)-2-methylalanyl)-2-methylalanyl)- LY 281217 LY-281217 N,N-Diallyl-tyrosyl-aminoisobutyric acid-aminoisobutyric acid-phenylalanine

pdb file: 705325.pdb
sdf file: 705325.sdf
directory: 705325

2-Ala-5-pronh2-enkephalin 66864-07-1 Enkephalin, ala(2)-pronh2(5)- Enkephalin, alanyl(2)-prolinamide(5)- Enkephalinamide, ala(2)-pro(5)- L-Prolinamide, L-tyrosyl-D-alanylglycyl-L-phenylalanyl- Wy 42,186

pdb file: 705328.pdb
sdf file: 705328.sdf
directory: 705328

67223-73-8 D-Alanine, N-(N-(N2-((1,1-dimethylethoxy)carbonyl)-L-lysyl)-D-alanyl)- t-Boc-lys-ala-ala tert-Butyloxycarbonyl-lysyl-alanyl-alanine

pdb file: 705345.pdb
sdf file: 705345.sdf
directory: 705345

(S-(R*,R*))-N-(N2-(((4-Cyclohexyl-3-((N-(N-((1,1-dimethylethoxy)carbonyl)-L-phenylalanyl)-L-histidyl)amino)-2-hydroxybutyl)(1-methylethyl)amino)carbonyl)-L-lysyl)-L-phenylalanine 105116-61-8 CP 69799 CP-69,799 L-Phenylalanine, N-(N2-(((4-cyclohexyl-3-((N-(N-((1,1-dimethylethoxy)carbonyl)-L-phenylalanyl)-L-histidyl)amino)-2-hydroxybutyl)(1-methylethyl)amino)carbonyl)-L-lysyl)-, (S-(R*,R*))-

pdb file: 705385.pdb
sdf file: 705385.sdf
directory: 705385

13187-90-1 Alanine glutamate Alanylglutamate L-Glutamic acid, N-L-alanyl- L-Glutamic acid, compd., with L-alanine (1:1)

pdb file: 705425.pdb
sdf file: 705425.sdf
directory: 705425

1-(N-(N-(2-Aminobenzoyl)glycyl)-4-nitro-L-phenylalanyl)-L-proline 2-Aminobenzoylglycyl-4-nitrophenylalanyl-proline 67482-93-3 EINECS 266-699-1 L-Proline, 1-(N-(N-(2-aminobenzoyl)glycyl)-4-nitro-L-phenylalanyl)-, (3R-(3alpha,4abeta,5beta,6beta,6aalpha,10alpha,10abeta,10balpha))-

pdb file: 705445.pdb
sdf file: 705445.sdf
directory: 705445

2-Ala-melphalan methyl ester-leu-enkephalin 2-Alanyl-leucine enkephalin melphalan ester 88457-22-1 Dadl-mel-ome Enkephalin-leu, ala(2)-melphalan methyl ester- Enkephalin-leu, alanine(2)-melphalan methyl ester- L-Phenylalanine, 4-(bis(2-chloroethyl)amino)-N-(N-(N-(N-(N-L-tyrosyl-D-alanyl)glycyl)-L-phenylalanyl)-L-leucyl)-, methyl ester Leu-enkephalin, ala(2)-melphalan methyl ester- Leucine-enkephalin, ala(2)-melphalan methyl ester-

pdb file: 705463.pdb
sdf file: 705463.sdf
directory: 705463

88793-96-8 H-Hexahydrotyrosyl-norleucyl-arginine-4-nitroanilide H-Nle-hht-lys-pna H-Norleucyl-hexahydrotyrosyl-lysine-4-nitroanilide L-Argininamide, D-norleucyl-3-(4-hydroxycyclohexyl)-L-alanyl-L-lysyl-N-(4-nitrophenyl)- Spectrozyme PL Spectrozyme-PL

pdb file: 705489.pdb
sdf file: 705489.sdf
directory: 705489

90549-86-3 Glycine, N-methyl-N-(N-(N2-L-tyrosyl-D-arginyl)-L-phenylalanyl)- TAPS Tyr-arg-phe-sar-OH Tyrosyl-arginyl-phenylalanyl-sarcosine

pdb file: 705515.pdb
sdf file: 705515.sdf
directory: 705515

119876-43-6 L-Argininamide, N-(3-methoxy-1,3-dioxopropyl)-2-methylalanyl-N-(4-nitrophenyl)- Methylmalonyl-methylalanyl-arginyl-p-nitroaniline SQ 68 SQ-68

pdb file: 705572.pdb
sdf file: 705572.sdf
directory: 705572

119935-96-5 Mercaptomethyl-4-methylpentanoyl-phenylalanylalaninamide Mmmp-phe-alanh2

pdb file: 705574.pdb
sdf file: 705574.sdf
directory: 705574

119980-12-0 Asn-ala-lys-thr-ile-ile-val-gln-leu L-Leucine, N-(N2-(N-(N-(N-(N-(N2-(N-L-asparaginyl-L-alanyl)-L-lysyl)-L-threonyl)-L-isoleucyl)-L-isoleucyl)-L-valyl)-L-glutaminyl)- Naktiivql Naktiivql nanopeptide

pdb file: 705581.pdb
sdf file: 705581.sdf
directory: 705581

(S)-1-(N-(8-Amino-1-carboxyoctyl)-L-alanyl)-L-proline 120008-53-9 AB 47 BRN 3596741 L-Proline, 1-(N-(8-amino-1-carboxyoctyl)-L-alanyl)-, (S)- N-(8-Amino-1(S)-carboxyoctyl)-L-alanyl-L-proline

pdb file: 705586.pdb
sdf file: 705586.sdf
directory: 705586

(S)-N-(2-(Mercaptomethyl)-4-methyl-1-oxopentyl)-L-phenylalanyl-L-alaninamide 120020-30-6 HS-Leu-phe-ala-NH2 HS-Leucyl-phenylalanyl-alaninamide L-Alaninamide, N-(2-(mercaptomethyl)-4-methyl-1-oxopentyl)-L-phenylalanyl-, (S)-

pdb file: 705587.pdb
sdf file: 705587.sdf
directory: 705587

105496-35-3 D-Valine, N-(N-(N-(3-mercapto-N-L-tyrosyl-D-valyl)glycyl)-L-phenylalanyl)- H-Tyr-pen-gly-phe-val-OH LY 190388 LY-190388 Tyr-penicillamine-gly-phe-val Tyrosyl-penicillaminyl-glycyl-phenylalaninyl-valine

pdb file: 705609.pdb
sdf file: 705609.sdf
directory: 705609

105655-57-0 L-Alanine, L-threonyl-L-alpha-glutamyl-L-asparaginyl-L-alpha-aspartyl-L-alanyl-L-leucyl-L-alpha-glutamyl-L-prolyl-L-alpha-glutamyl-L-alpha-aspartyl-L-leucyl-L-prolyl-L-glutaminyl-L-alanyl- Prosomatostatin (63-77) Prosomatostatin cryptic peptide

pdb file: 705652.pdb
sdf file: 705652.sdf
directory: 705652

120287-83-4 D-Alaninamide, N-acetyl-3-(2-naphthalenyl)-D-alanyl-4-chloro-D-phenylalanyl-D-tryptophyl-L-seryl-L-tyrosyl-N6-(aminocarbonyl)-D-lysyl-L-leucyl-L-arginyl-L-prolyl- GNRH, N-Ac-2-nal(1)-4-Cl-phe(2)-trp(3)-hci(6)-alanh2(10)- LHRH, N-Acetyl-2-naphthalenylalanyl(1)-4-chlorophenylalanyl(2)-tryptophyl(3)-homocitrullinyl(6)-alaninamide(10)- LHRH, N-ac-2-Nal(1)-4-Cl-phe(2)-trp(3)-hci(6)-alanh2(10)- N-Ac-1-(2-Nal)-2-(4-Cl-phe)-3-trp-6-hci-10-alanh2-LHRH SB 29 SB-29

pdb file: 705671.pdb
sdf file: 705671.sdf
directory: 705671

120287-84-5 D-Alaninamide, N-acetyl-3-(2-naphthalenyl)-D-alanyl-4-chloro-D-phenylalanyl-D-tryptophyl-L-seryl-L-tyrosyl-N5-(aminocarbonyl)-D-ornithyl-L-leucyl-L-arginyl-L-prolyl- GNRH, N-Ac-nal(1)-4-Cl-phe(2)-trp(3)-cit(6)-alanh2(10)- LHRH, N-Acetyl-(2-naphthalenyl)alanyl(1)-4-chlorophenylalanyl(2)-tryptophyl(3)-citrullinyl(6)-alaninamide(10)- LHRH, N-ac-Nal(1)-4-Cl-phe(2)-trp(3)-cit(6)-alanh2(10)- N-Ac-1-(2-Nal)-2-(4-Cl-phe)-3-trp-6-cit-10-alanh2-LHRH SB 30 SB-30

pdb file: 705673.pdb
sdf file: 705673.sdf
directory: 705673

120396-89-6 L-Alanyl-L-arginyl-L-arginyl-L-lysyl-L-tryptophyl-L-glutaminyl-L-lysyl-L-threonylglycyl-L-histidyl-L-alanyl-L-valyl-L-arginyl-L-alanyl-L-isoleucylglycyl-L-arginyl-L-leucyl-L-seryl-L-serine L-Serine, L-alanyl-L-arginyl-L-arginyl-L-lysyl-L-tryptophyl-L-glutaminyl-L-lysyl-L-threonylglycyl-L-histidyl-L-alanyl-L-valyl-L-arginyl-L-alanyl-L-isoleucylglycyl-L-arginyl-L-leucyl-L-seryl- RS 20 RS-20

pdb file: 705710.pdb
sdf file: 705710.sdf
directory: 705710

120484-56-2 2-(N'-Acetylphenylalanyl)hydroxyethyl 2'-pyridyl disulfide 2-Aphpd

pdb file: 705740.pdb
sdf file: 705740.sdf
directory: 705740

120667-90-5 Dbi 17-50 Diazepam binding inhibitor 17-50 L-Lysine, L-threonyl-L-glutaminyl-L-propyl-L-threonyl-L-alpha-aspartyl-L-alpha-glutamyl-L-alpha-glutamyl-L-methionyl-L-leucyl-L-phenylalanyl-L-isoleucyl-L-tyrosyl-L-seryl-L-histidyl-L-phenylalanyl-L-lysyl-L-glutaminyl-L-alanyl-L-threonyl-L-valylglycyl-L-alpha-aspartyl-L-valyl-L-asparaginyl-L-threonyl-L-alpha-aspartyl-L-arginyl-L-propylglycyl-L-leucyl-L-leucyl-L-alpha-aspartyl-L-leucyl- Rat brain triakontatreaneuropeptide TTTN Triakontatetraneuropeptide

pdb file: 705801.pdb
sdf file: 705801.sdf
directory: 705801

120841-31-8 Glycinamide, N-(2,2-dimethyl-1-oxopropyl)-L-alanyl-N-(1-methylethyl)- Tbuco-ala-gly-nhipr t-Boc-ala-gly-nhipr tert-Butoxycarbonyl-alanyl-glycyl-isopropylamide

pdb file: 705822.pdb
sdf file: 705822.sdf
directory: 705822

121119-48-0 Compound 88-62 HEAPI His-glu-ala-pro-ile Histidyl-glutamyl-alanyl-prolyl-isoleucine

pdb file: 705926.pdb
sdf file: 705926.sdf
directory: 705926

121258-38-6 Ol-Ala-ala-pro-val-NH2 Oleoylalanyl-alanyl-prolyl-valinamide Oleoylalanyl-alanyl-prolyl-valine amide

pdb file: 705947.pdb
sdf file: 705947.sdf
directory: 705947

121258-39-7 L-Valinamide, N-(1-oxo-9-octadecenyl)-L-alanyl-L-alanyl-L-prolyl-N-propyl-, (Z)- Ol-Ala-ala-pro-val-NH-C3H7 Oleoylalanyl-alanyl-prolyl-N-propylvalinamide

pdb file: 705948.pdb
sdf file: 705948.sdf
directory: 705948

121264-05-9 A 68567 A-68567 Butanamide, N-(((1-carboxy-2-(1H-indol-3-yl)ethyl)amino)carbonyl)alanyl-N3-(N-alanyl-3-hydroxyphenylalanyl)-N-((5-(3,4-dihydro-2,4-dioxo-1(2H)-pyrimidinyl)dihydro-4-hydroxy-2(3H)-furanylidene)methyl)-N3-methyl-2,3-diamino- Pacidamycin 1

pdb file: 705955.pdb
sdf file: 705955.sdf
directory: 705955

121264-06-0 Butanamide, N-(((1-carboxy-2-phenylethyl)amino)carbonyl)alanyl-N3-(N-alanyl-3-hydroxyphenylalanyl)-N-((5-(3,4-dihydro-2,4-dioxo-1(2H)-pyrimidinyl)dihydro-4-hydroxy-2(3H)-furanylidene)methyl)-N3-methyl-2,3-diamino- N-(((1-Carboxy-2-phenylethyl)amino)carbonyl)alanyl-N3-(N-alanyl-3-hydroxyphenylalanyl)-N-((5-(3,4-dihydro-2,4-dioxo-1(2H)-pyrimidinyl)dihydro-4-hydroxy-2(3H)-furanylidene)methyl)-N3-methyl-2,3-diaminobutanamide Pacidamycin 2

pdb file: 705957.pdb
sdf file: 705957.sdf
directory: 705957

121280-49-7 Butanamide, N-(((1-carboxy-2-(3-hydroxyphenyl)ethyl)amino)carbonyl)alanyl-N3-(N-alanyl-3-hydroxyphenylalanyl)-N-((5-(3,4-dihydro-2,4-dioxo-1(2H)-pyrimidinyl)dihydro-4-hydroxy-2(3H)-furanylidene)methyl)-N3-methyl-2,3-diamino- Pacidamycin 3

pdb file: 705958.pdb
sdf file: 705958.sdf
directory: 705958

121282-17-5 2,4-Dinitrophenylprolyl-leucyl-glycyl-leucyl-tryptophyl-alanyl-argininamide Dnp-pro-leu-gly-leu-trp-ala-arg-NH2 Dplgltaa

pdb file: 705961.pdb
sdf file: 705961.sdf
directory: 705961

121428-48-6 Gly-ala-val Glycyl-alanyl-valine L-Valine, N-(N-glycyl-L-alanyl)-

pdb file: 705983.pdb
sdf file: 705983.sdf
directory: 705983

121501-21-1 L-Arginine, L-prolyl-L-alpha-aspartyl-L-threonyl-L-arginyl-L-prolyl-L-alanyl-L-prolylglycyl-L-seryl-L-threonyl-L-alanyl-L-prolyl-L-prolyl-L-alanyl-L-histidylglycyl-L-valyl-L-threonyl-L-seryl-L-alanyl-L-prolyl-L-alpha-aspartyl-L-threonyl- Peptide p(1-24) p(1-24) Peptide

pdb file: 705995.pdb
sdf file: 705995.sdf
directory: 705995

((1,1-Dimethylethoxy)carbonyl)-L-phenylalanyl-N(1-(cyclohexylmethyl)-2-hydroxy-2-(1H-imidazol-2-yl)ethyl)-L-histidinamide 121995-36-6 Boc-phe-N-(-1-(cyclohexylmethyl)-2-hydroxy-2-(1H-imidazol-2-yl)ethyl)histidinamide L-Histidinamide, N-((1,1-dimethylethoxy)carbonyl)-L-phenylalanyl-nalpha-(1-(cyclohexylmethyl)-2-hydroxy-2-(1H-imidazol-2-yl)ethyl)-, (R-(R*,S*))- SQ 30774 SQ-30774

pdb file: 706093.pdb
sdf file: 706093.sdf
directory: 706093

122001-05-2 L-Leucinamide, N-acetyl-L-histidyl-L-tryptophyl-L-alanyl-L-valylglycyl-L-histidyl-N-ethyl- N-Acetyl-gastrin releasing peptide (20-26) ethyl ester N-Acetyl-grp-20-26-och2CH3 N-Grp-EE

pdb file: 706095.pdb
sdf file: 706095.sdf
directory: 706095

122018-91-1 L-Threonine, N-(N-(N-(N-(N-(N-(N-(1-(N-L-seryl-L-phenylalanyl)-L-prolyl)-L-tryptophyl)-L-methionyl)-L-alpha-glutamyl)-L-seryl)-L-alpha-aspartyl)-L-valyl)- Prepro-thyrotropin releasing hormone (160-169) Prepro-trh (160-169) Ser-phe-pro-trp-met-glu-ser-asp-val-thr Seryl-phenylalanyl-prolyl-tryptophyl-methionyl-glutamyl-seryl-asparaginyl-valyl-threonine Thyrotropin-releasing hormone-potentiating peptide Trh-potentiating peptide

pdb file: 706112.pdb
sdf file: 706112.sdf
directory: 706112

122018-92-2 L-Glutamic acid, L-phenylalanyl-L-isoleucyl-L-alpha-aspartyl-L-prolyl-L-alpha-glutamyl-L-leucyl-L-glutaminyl-L-arginyl-L-seryl-L-typtophyl-L-alpha-glutamyl-L-alpha-glutamyl-L-lysyl-L-alpha-glutamylglycyl-L-alpha-glutamylglycyl-L-valyl-L-leucyl-L-methionyl-L-prolyl- Prepro-thyrotropin-releasing hormone (178-199) Prepro-trh (178-199) Preprothyrotropin-releasing hormone (178-199)

pdb file: 706117.pdb
sdf file: 706117.sdf
directory: 706117

122075-70-1 Flrf peptide L-Phenylalanine, N-(N2-(N-L-phenylalanyl-L-leucyl)-L-arginyl)- N-(N2-(N-L-Phenylalanyl-L-leucyl)-L-arginyl)-L-phenylalanine Phe-leu-arg-phe Phenylalanyl-leucyl-arginyl-phenylalanine

pdb file: 706128.pdb
sdf file: 706128.sdf
directory: 706128

122088-76-0 Cgp 38560 Cgp 38560A Cgp-38560 L-Valinamide, N-(2-(((1,1-dimethylethyl)sulfonyl)methyl)-1-oxo-3-phenylpropyl)-L-histidyl-3-cyclohexyl-L-alanyl-N-butyl-, (R)-, monomethanesulfonate N-(2-Benzyl-3-tert-butylsulfonylpropionyl)-his-cha-val-n-butylamide

pdb file: 706133.pdb
sdf file: 706133.sdf
directory: 706133

2-O-Acetyl-ala-2-N-Me-met-enkephalinamide 69924-15-8 Enkephalinamide-met, O-Ac-ala(2)-N(2)-Me- Enkephalinamide-met, O-acetylalanyl(2)-N(2)-methyl- L-Methioninamide, O-acetyl-L-tyrosyl-D-alanylglycyl-L-phenylalanyl-N2-methyl- Lilly 127623 Met-enkephalinamide, O-Ac-ala(2)-N(2)-Me- Methionine-enkephalinamide, O-Ac-ala(2)-N(2)-Me- O-Acetyl-2-alanyl-2-N-methyl-methionine enkephalinamide

pdb file: 706210.pdb
sdf file: 706210.sdf
directory: 706210

(1S)-N-Methyl-L-tyrosyl-D-alanylglycyl-N-(1-(hydroxymethyl)-3-(methylsulfinyl)propyl)-Nalpha-methyl-L-phenylalaninamide 1-N-Me-2-Ala-N-(1-hydroxy-Me)-3-(Me-sulfinyl)propyl-N(alpha)-Me-4-phenh2-enkephalin 70021-31-7 Enkephalin, 1-N-methyl-ala(2)-N-(1-(hydroxymethyl)-3-(methylsulfinyl)propyl)-N(alpha)-methyl-phenh(4)- Enkephalin, 1-N-methyl-alalnyl(2)-N(1-(hydroxymethyl)-3-(methylsulfinyl)propyl)-N-(alpha)-methyl-phenylalaninamide(4)- FW 34-569 FW 34569 L-Phenylalaninamide, N-methyl-L-tyrosyl-D-alanylglycyl-N-(1-(hydroxymethyl)-3-(methylsulfinyl)propyl)-Nalpha-methyl-, (1S)-

pdb file: 706218.pdb
sdf file: 706218.sdf
directory: 706218

122280-12-0 L-Leucinamide, N-(6-amino-1-oxohexyl)-L-phenylalanyl-N-(1-(cyclohexylmethyl)-2-hydroxy-2-(2-thiazolyl)ethyl)-, (R-(R*,S*))- SQ 32970 SQ-32,970

pdb file: 706227.pdb
sdf file: 706227.sdf
directory: 706227

122289-52-5 Epitope 31D L-Alanyl-L-valyl-L-tyrosyl-L-threonyl-L-arginyl-L-isoleucyl-L-methionyl-L-methionyl-L-asparaginylglycylglycyl-L-arginyl-L-leucyl-L-lysyl-L-arginine L-Arginine, L-alanyl-L-valyl-L-tyrosyl-L-threonyl-L-arginyl-L-isoleucyl-L-methionyl-L-methionyl-L-asparaginylglycylglycyl-L-arginyl-L-leucyl-L-lysyl- Peptide 31D

pdb file: 706229.pdb
sdf file: 706229.sdf
directory: 706229

1-N-Ac-3(2-Naphthyl)ala-2-(4-Cl-phe)-3,7-phe-6,8-arg-10-alanh2-LHRH 106881-54-3 Bim 21009 Bim-21009 D-Alaninamide, N-acetyl-3-(2-naphthalenyl)-D-alanyl-4-chloro-D-phenylalanyl-D-phenylalanyl-L-seryl-L-tyrosyl-D-arginyl-L-phenylalanyl-L-arginyl-L-prolyl- GNRH, N-Ac-3(2-naphthyl)ala(1)-(4-Cl-phe)(2)-phe(3,7)-arg(6,8)-alanh2(10)- LHRH, N-Ac-3(2-Naphthyl)ala(1)-(4-Cl-phe)(2)-phe(3,7)-arg(6,8)-alanh2(10)- LHRH, N-Acetyl-3(2-naphthyl)alanyl(1)-4-chlorophenylalanyl(2)-phenylalanyl(3,7)-arginyl(6,8)-alaninamide(10)- LHRH-Ncpapa

pdb file: 706252.pdb
sdf file: 706252.sdf
directory: 706252

122548-03-2 Glycinamide, L-histidyl-3-hydroxy-L-tyrosyl-N-(2-(6-bromo-1H-indol-3-yl)ethenyl)-, (Z)- Halocyamine A Histidyl-6,7-dihydroxyphenylalanylglycyl-6-bromo-8,9-didehydrotryptamine

pdb file: 706276.pdb
sdf file: 706276.sdf
directory: 706276

122560-16-1 L-Methionine, L-threonyl-L-arginyl-L-alpha-aspartyl-L-valyl-L-leucyl-L-asparaginyl-L-leucyl-L-tyrosyl-L-alanyl-L-alpha-aspartyl-L-phenylalanyl-L-isoleucyl-L-alanyl-L-seryl- L-Threonyl-L-arginyl-L-alpha-aspartyl-L-valyl-L-leucyl-L-asparaginyl-L-leucyl-L-tyrosyl-L-alanyl-L-alpha-aspartyl-L-phenylalanyl-L-isoleucyl-L-alanyl-L-seryl-L-methionine MT162-176 antigen Polyoma peptide antigen MT162-176

pdb file: 706280.pdb
sdf file: 706280.sdf
directory: 706280

122855-43-0 Butanamide, N-(((1-carboxy-2-phenylethyl)amino)carbonyl)alanyl-N-((5-(3,4-dihydro-2,4-dioxo-1(2H)-pyrimidinyl)dihydro-4-hydroxy-2(3H)-furanylidene)methyl)-N3-(3-hydroxyphenylalanyl)-N3-methyl-2,3-diamino- Pacidamycin 5

pdb file: 706313.pdb
sdf file: 706313.sdf
directory: 706313

70904-78-8 Benzyloxycarbonyl alpha-aminoisobutyryl-alpha-aminoisobutyryl-N-methylalaninamide Benzyloxycarbonyl-aib-aib-ala-nhme L-Alaninamide, 2-methyl-N-((phenylmethoxy)carbonyl)alanyl-2-methylalanyl-N-methyl- Z-Aib-aib-ala-nhme

pdb file: 706382.pdb
sdf file: 706382.sdf
directory: 706382

123001-63-8 CP 14 CP-14 L-Leucine, L-seryl-L-prolyl-L-seryl-L-valyl-L-alpha-glutamyl-L-arginyl-L-valyl-L-phenylalanyl-L-seryl-L-alanyl-L-seryl-L-prolyl-L-alanyl- Ser-pro-ser-val-glu-arg-val-phe-ser-ala-ser-pro-ala-leu Seryl-prolyl-seryl-valyl-glutamyl-arginyl-valyl-phenylalanyl-seryl-alanyl-seryl-prolyl-alanyl-leucine

pdb file: 706386.pdb
sdf file: 706386.sdf
directory: 706386

123067-53-8 6-Glu-substance P (6-11) 6-Glutamic acid-substance P (6-11) L-Methioninamide, L-alpha-glutamyl-L-phenylalanyl-L-phenylalanylglycyl-L-leucyl- Substance P (6-11), glu(6)- Substance P (6-11), glutamic acid(6)-

pdb file: 706416.pdb
sdf file: 706416.sdf
directory: 706416

123285-45-0 L-Prolinamide, N-(4-methoxy-1,4-dioxobutyl)-L-alanyl-L-alanyl-N-(3,3,3-trifluoro-1-(1-methylethyl)-2-oxopropyl)-, (S)- Mdl 27,013 Mdl 27013

pdb file: 706457.pdb
sdf file: 706457.sdf
directory: 706457

123285-50-7 Dansyl-ala-ala-pro-val-CF3 L-Prolinamide, N-((5-(dimethylamino)-1-naphthalenyl)sulfonyl)-L-alanyl-L-alanyl-N-(3,3,3-trifluoro-1-(1-methylethyl)-2-oxopropyl)-, (S)- MDL 27,324 MDL 27324

pdb file: 706459.pdb
sdf file: 706459.sdf
directory: 706459

123496-54-8 L-Lysinamide, L-tyrosyl-L-alanyl-N-(4-((aminoiminomethyl)amino)-1-(chloroacetyl)butyl)- Tyr-ala-lys-arg chloromethyl ketone Tyrosyl-alanyl-lysyl-arginine chloromethyl ketone Yakr-CK

pdb file: 706500.pdb
sdf file: 706500.sdf
directory: 706500

123496-58-2 L-Aspartic acid, N-(N2-(N2-(N-L-tyrosyl-L-phenylalanyl)-L-arginyl)-L-lysyl)- Tyr-phe-arg-lys-asp Tyrosyl-phenylalanyl-arginyl-lysyl-aspartic acid YFRKD

pdb file: 706501.pdb
sdf file: 706501.sdf
directory: 706501

123689-72-5 H-His-D-arg-ala-trp-D-phe-lys-NH2 Haatpln Histidyl-arginyl-alanyl-tryptophyl-phenylalanyl-lysinamide L-Lysinamide, L-histidyl-D-arginyl-L-alanyl-L-tryptophyl-D-phenylalanyl-

pdb file: 706536.pdb
sdf file: 706536.sdf
directory: 706536

123712-62-9 Bz-Arg-gly-phe-pro-meo-Na L-Prolinamide, N2-benzoyl-L-arginylglycyl-L-phenylalanyl-N-(4-methoxy-2-naphthalenyl)- N(alpha)-Benzoyl-arg-gly-phe-pro-meo-beta-napthylamide N(alpha)-Benzoyl-arginyl-glycyl-phenylalanyl-prolyl-methoxy-beta-naphthylamide N2-Benzoyl-L-arginylglycyl-L-phenylalanyl-N-(4-methoxy-2-naphthalenyl)-L-prolinamide

pdb file: 706542.pdb
sdf file: 706542.sdf
directory: 706542

108093-87-4 G-Gly 7 Glycine, N-(N-(N-(N-(N-(N-L-tyrosylglycyl)-L-tryptophyl)-L-methionyl)-L-alpha-aspartyl)-L-phenylalanyl)- Glycine-extended gastrin 7 Glycine-extended pro-gastrin-processing intermediate GL7 Tyr-gly-trp-met-asp-phe-gly Tyrosyl-glycyl-tryptophyl-methionyl-aspartyl-phenylalanyl-glycine

pdb file: 706554.pdb
sdf file: 706554.sdf
directory: 706554

123769-98-2 6-Phe-13-leu-psi(CH2NH)-14-phe-bombesin (6-14) Bombesin (6-14), D-phe(6)-leu(13)-psi(CH2NH)-phe(14)- Bombesin (6-14), D-phenylalanyl(6)-leucyl(13)-psi(methyleneamino)-phenylalanyl(14)- L-Histidinamide, D-phenylalanyl-L-glutaminyl-L-tryptophyl-L-alanyl-L-valylglycyl-N-(1-(((2-amino-2-oxo-1-(phenylmethyl)ethyl)amino)methyl)-3-methylbutyl)-, (S-(R*,R*))- RC 3100 RC-3100

pdb file: 706559.pdb
sdf file: 706559.sdf
directory: 706559

(S)-N-Methyl-2-((2-methylpropyl)amino)propanamide 123886-73-7 128022-94-6 Isobutyryl-ala-ala-ala-NH-methyl Isobutyrylalanyl-alanyl-alanyl-methylamide Propanamide, N-methyl-2-((2-methylpropyl)amino)-, (S)- Tetra-ian

pdb file: 706585.pdb
sdf file: 706585.sdf
directory: 706585

124001-41-8 Ici 216140 Ici-216140 L-Leucinamide, N-(2-methyl-1-oxopropyl)-L-histidyl-L-tryptophyl-L-alanyl-L-valyl-D-alanyl-L-histidyl-N-methyl- N-Isobutyryl-his-trp-ala-val-ala-his-leu-nhme m 216140 m-216140 m216140

pdb file: 706599.pdb
sdf file: 706599.sdf
directory: 706599

124051-38-3 Khfrwg-NH2 Lys-his-phe-arg-trp-gly-NH2 Lysyl-histidyl-phenylalanyl-arginyl-tryptophyl-glycinamide

pdb file: 706603.pdb
sdf file: 706603.sdf
directory: 706603

124076-39-7 2-Met-5-hyp-galactopyranosyl-enkephalin 2-Methionyl-5-hydroxyprolyl-(beta-D-galactopyranosyl)enkephalinamide 4-(beta-D-galactopyranosyloxy)-1-(N-(N-(N-L-tyrosyl-D-methionyl)glycyl)-L-phenylalanyl)-L-prolinamide trans- Enkephalinamide, met(2)-hyp(5)galactopyranosyl- Enkephalinamide, methionyl(2)-hydroxyproline(5)-galactopyranosyl- L-Prolinamide, 4-(beta-D-galactopyranosyloxy)-1-(N-(N-(N-L-tyrosyl-D-methionyl)glycyl)-L-phenylalanyl)-, trans- Mhp-gal-enkephalinamide O(1.5)-beta-D-Galactopyranosyl(dmet(2),hyp(5))enkephalinamide

pdb file: 706615.pdb
sdf file: 706615.sdf
directory: 706615

124216-70-2 Acetylphenylalanyl-prolyl-bor-arginine L-Prolinamide, N-acetyl-D-phenylalanyl-N-(4-((aminoiminomethyl)amino)-1-boronobutyl)- P 8714 P-8714

pdb file: 706649.pdb
sdf file: 706649.sdf
directory: 706649

(3D)Y8Fa 124256-00-4 L-Phenylalaninamide, L-tyrosyl-L-leucyl-L-phenylalanyl-L-glutaminyl-L-prolyl-L-glutaminyl-L-arginyl Tyr-leu-phe-gln-pro-gln-arg-phe-NH2 Tyrosyl-leucyl-phenylalanyl-glutaminyl-prolyl-glutaminyl-arginyl-phenylalaninamide Y8Fa Peptide Ylfqpqrfa Ylfqpqrfamide

pdb file: 706654.pdb
sdf file: 706654.sdf
directory: 706654

90815-77-3 Glycinamide, L-tyrosyl-D-alanyl-N-(3-methylbutyl)- Trimu 5 Trimu-5 Tyr-D-ala-gly-NH-(CH2)2CH(CH3)2 Tyrosyl-D-alanyl-N-(3-methylbutyl)glycinamide

pdb file: 706683.pdb
sdf file: 706683.sdf
directory: 706683

124479-70-5 Dansyl-glycyl-lysyl-tyrosyl-alanyl-prolyl-tryptophyl-valine Dns-gltaptv Dns-gly-lys-tyr-ala-pro-trp-val

pdb file: 706700.pdb
sdf file: 706700.sdf
directory: 706700

124774-36-3 Snp nonapeptide Thr-phe-gly-leu-gln-leu-glu-leu-thr Threonyl-phenylalanyl-glycyl-leucyl-glutaminyl-leucyl-glutamyl-leucyl-threonine

pdb file: 706756.pdb
sdf file: 706756.sdf
directory: 706756

91464-97-0 H 261 H 261 Oligopeptide H-261 H-261 Oligopeptide L-Histidine, L-histidyl-L-prolyl-L-phenylalanyl-L-histidyl-(2S,4S,5S)-5-amino-4-hydroxy-7-methyl-2-(1-methylethyl)octanoyl-L-isoleucyl- L-Histidine, N-(N-(5-((N-(N-(1-L-histidyl-L-prolyl)-L-phenylalanyl)-L-histidyl)amino)-4-hydroxy-7-methyl-2-(1-methylethyl)-1-oxooctyl)-L-isoleucyl)-, (2S-(2R*,4R*,5R*))- his-pro-phe-his-leu(OH)-val-ile-his

pdb file: 706766.pdb
sdf file: 706766.sdf
directory: 706766

91879-73-1 L-Serine, L-seryl-L-seryl-L-leucyl-L-lysyl-L-alpha-glutamyl-L-tyrosyl-L-tryptophyl-L-seryl-L-seryl-L-leucyl-L-lysyl-L-alpha-glutamyl-L-seryl-L-phenylalanyl- Lap 15 Lap 20 Lipid-associating peptide Lipid-associating peptides

pdb file: 706784.pdb
sdf file: 706784.sdf
directory: 706784

93299-11-7 Chloroethylnitrosocarbamoyl-alanyl-alanine Cnc-ala-ala Cnc-alanylalanine L-Alanine, N-(N-(((2-chloroethyl)nitrosoamino)carbonyl)-L-alanyl)- N-(N-(((2-Chloroethyl)nitrosoamino)carbonyl)-L-alanyl)-L-alanine

pdb file: 706820.pdb
sdf file: 706820.sdf
directory: 706820

70967-90-7 Aapv-NA L-Valinamide, N-(4-methoxy-1,4-dioxobutyl)-L-alanyl-L-alanyl-L-prolyl-N-(4-nitrophenyl)- Meo-suc-ala-ala-pro-val-NA N-(4-Methoxy-1,4-dioxobutyl)-L-alanyl-L-alanyl-L-prolyl-N-(4-nitrophenyl)-L-valinamide N-Methoxysuccinyl-alanyl-alanyl-prolyl-valine-4-nitroanilide N-Methoxysuccinyl-alanyl-alanyl-prolyl-valine-p-nitroanilide

pdb file: 706860.pdb
sdf file: 706860.sdf
directory: 706860

125316-77-0 3-O-(2-Acetamido-2-deoxygalactopyranosyl)-acetyl-threonyl-alanyl-alanine methyl ester Ac-Thr(alpha-galnac)-ala-ala-ome Atgaaam L-Alanine, N-(N-(N-acetyl-O-(2-(acetylamino)-2-deoxy-alpha-D-galactopyranosyl)-L-threonyl)-L-alanyl)-, methyl ester N-(N-(N-Acetyl-O-(2-(acetylamino)-2-deoxy-alpha-D-galactopyranosyl)-L-threonyl)-L-alanyl)-L-alanine methyl ester

pdb file: 706911.pdb
sdf file: 706911.sdf
directory: 706911

125399-14-6 L-Leucinamide, N-(cyclopentylcarbonyl)-L-phenylalanyl-N-(1-(cyclohexylmethyl)-2-(dimethoxyphosphinyl)-2-hydroxyethyl)- SQ 32,602 SQ 32602

pdb file: 706927.pdb
sdf file: 706927.sdf
directory: 706927

98813-21-9 Cys-glu-asn-pro-ser-gln-phe-tyr-glu-asp-leu Cysteinyl-glutamyl-asparaginyl-prolyl-serinyl-glutaminyl-phenylalanyl-tyrosyl-glutamyl-aspartyl-leucine L-Leucine, N-(N-(N-(N-(N-(N2-(N-(1-(N2-(N-L-cysteinyl-L-alpha-glutamyl)-L-asparginyl)-L-prolyl)-L-seryl)-L-glutaminyl)-L-phenylalanyl)-L-tyrosyl)-L-alpha-glutamyl)-L-alpha-aspartyl)- Synthetic peptide Sp-23

pdb file: 706939.pdb
sdf file: 706939.sdf
directory: 706939

125636-77-3 Asn-ser(4)-gly-ser(2)-gly-ala-gly-gln-cooh L-Glutamine, N2-(N-(N-(N-(N-(N-(N-(N-(N-(N-(N-L-asparaginyl-L-sseryl)-L-seryl)-L-seryl)-L-seryl)glycyl)-L-seryl)-L-seryl)glycyl)-L-alanyl)glycyl)- Msh, gamma, (15-26) gamma-3-Melanotropin (15-26)

pdb file: 706976.pdb
sdf file: 706976.sdf
directory: 706976

101162-62-3 Cck-tfp Cholecystokinin C-terminal flanking peptide Cholecystokinin precursor-related nonapeptide Gly-arg-arg-ser-ala-glu-asp-tyr-glu-tyr-pro-ser Glycyl-arginyl-arginyl-seryl-alanyl-glutamyl-aspartyl-tyrosyl-glutamyl-tyrosyl-prolyl-serine L-Serine, N-(1-(N-(N-(N-(N-(N-(N-L-seryl-L-alanyl)-L-alpha-glutamyl)-L-alpha-aspartyl)-O-sulfo-L-tyrosyl)-L-alpha-glutamyl)-O-sulfo-L-tyrosyl)-L-prolyl)- Peptide serine serine

pdb file: 706998.pdb
sdf file: 706998.sdf
directory: 706998

2-(N-Hydroxycarboxamido)-4-methylpentanoyl-alanyl-glycinamide 71431-46-4 Glycinamide, N-(2-((hydroxyamino)carbonyl)-4-methyl-1-oxopentyl)-L-alanyl- HC-MP-Ala-glynh2 Zincov

pdb file: 707045.pdb
sdf file: 707045.sdf
directory: 707045

109022-88-0 Ac-Nle-gln-his-D-phe-arg-D-trp-gly-NH2 Acetyl-norleucyl-glutaminyl-histidyl-phenylalanyl-arginyl-tryptophyl-glycinamide Glycinamide, L-norleucyl-L-glutaminyl-L-histidyl-L-phenylalanyl-L-arginyl-L-tryptophyl- HP 228 L-Norleucyl-L-glutaminyl-L-histidyl-L-phenylalanyl-L-arginyl-L-tryptophylglycinamide

pdb file: 707077.pdb
sdf file: 707077.sdf
directory: 707077

(Ser(2)(O-t-butyl)-leu(5))enkephalyl-thr(6) 110786-67-9 111035-56-4 Dstbulet L-Threonine, N-(N-(N-(N-(O-(1,1-dimethylethyl)-N-L-tyrosyl-D-seryl)glycyl)-L-phenylalanyl)-L-leucyl)- Leu(5) enkephalin, ser(2)(O-tert-butyl)-thr(6) Tyr-ser(O-tert-Bu)-gly-phe-leu-thr Tyrosyl-seryl(O-tert-butyl)-glycyl-phenylalanyl-leucyl-threonine

pdb file: 707142.pdb
sdf file: 707142.sdf
directory: 707142

(Ser(2)(O-tert-butyl)-leu(5))enkephalyl-thr(6)(O-tert-butyl) 111035-57-5 BUBU L-Threonine, N-(N-(N-(N-(O-(1,1-dimethylethyl)-N-L-tyrosyl-D-seryl)glycyl)-L-phenylalanyl)-L-leucyl)-, 1,1-dimethylethyl ester Leu(5)-enkephalin, ser(2)(O-tert-butyl)-thr(6)(O-tert-butyl) Tyr-ser(O-tert-Bu)-gly-phe-leu-thr(O-tert-Bu) Tyrosyl-seryl(O-t-butyl)-glycyl-phenylalanyl-leucyl-threonine(O-t-butyl)

pdb file: 707143.pdb
sdf file: 707143.sdf
directory: 707143

111364-35-3 AI-Mdp L-Phenylalanine, N-(N2-(N-(N-acetylmuramoyl)-L-alanyl)-D-alpha-glutaminyl)-4-azido-3-iodo-, methyl ester N-Acetylmuramyl-alanyl-isoglutaminyl-(3'-iodo-4'-azidophenylalanine) methyl ester

pdb file: 707154.pdb
sdf file: 707154.sdf
directory: 707154

112160-96-0 L-Arginine, N2-(N-(N-(N2-(N-(N-(N-(N-(N-(N-(N-L-histidyl-L-seryl)-L-alpha-aspartyl)-L-alanyl)-L-leucyl)-L-phenylalanyl)-L-threonyl)-L-alpha-aspartyl)-L-asparaginyl)-L-tyrosyl)-L-threonyl)- Vasoactive intestinal peptide (1-12) Vip (1-12)

pdb file: 707183.pdb
sdf file: 707183.sdf
directory: 707183

113611-67-9 L-Phenylalaninamide, L-seryl-L-alpha-aspartyl-L-arginyl-L-asparaginyl-L-phenylalanyl-L-leucyl-L-arginyl- L-Seryl-L-alpha-aspartyl-L-arginyl-L-asparaginyl-L-phenylalanyl-L-leucyl-L-arginyl-L-phenylalaninamide Sdrnflrfamide Ser-asp-arg-asn-phe-leu-arg-phe-NH2 Seryl-aspartyl-arginyl-asparaginyl-phenylalanyl-leucyl-arginyl-phenylalaninamide

pdb file: 707209.pdb
sdf file: 707209.sdf
directory: 707209

74075-25-5 BPGP L-Proline, 1-(N-(N-benzoyl-L-phenylalanyl)glycyl)- N-Benzoyl-phe-gly-pro N-Benzoylphenylalanyl-glycyl-proline

pdb file: 707312.pdb
sdf file: 707312.sdf
directory: 707312

126370-66-9 6H-Pyrrolo(1,2-e)(1,2,5,8)thiatriazecine-1,8(2H,7H)-dione, hexahydro-2-methyl-7-(phenylmethyl)-, 5,5-dioxide, (7S-(7R*,12aS*))- Cyclo(-Me-tau-phe-pro-) Cyclo(metau-phe-pro) Cyclo(methyltauryl-phenylalanyl-proline)

pdb file: 707347.pdb
sdf file: 707347.sdf
directory: 707347

127231-42-9 Ac-Ser-leu-asn-(phe-hea-pro)-ile-val-ome Alap-hea-piv L-Valine, N-(N-(1-(3-((N2-(N-(N-acetyl-L-seryl)-L-leucyl)-L-asparaginyl)amino)-2-hydroxy-4-phenylbutyl)-L-prolyl)-L-isoleucyl)-, methyl ester, (S-(R*,R*))- N-Acetylseryl-leucyl-asparaginyl(phenylalanyl-hydroxyethylamino-prolyl)isoleucyl-valyl methyl ester

pdb file: 707382.pdb
sdf file: 707382.sdf
directory: 707382

127363-91-1 Alanine, N-(N-(N-(N-(N-(N-(N-(N-((1,1-dimethylethoxy)carbonyl)-L-valyl)-L-alanyl)-L-leucyl)-2-methylalanyl)-L-valyl)-L-alanyl)-L-leucyl)-2-methyl-, methyl ester Boc-val-ala-leu-aib-val-ala-leu-aib-ome Valu-8 t-Butyloxycarbonyl-valyl-alanyl-leucyl-2-aminoisobutyryl-valyl-alanyl-leucyl-2-aminoisobutyryl methyl ester

pdb file: 707391.pdb
sdf file: 707391.sdf
directory: 707391

127627-13-8 443C81 L-Prolinamide, D-tyrosyl-L-arginylglycyl-4-nitro-L-phenylalanyl- Tyr-arg-gly-(4-nitrophenyl-phe)-pronh2 Tyrosyl-arginyl-glycyl-4-nitrophenylalanyl-prolinamide

pdb file: 707413.pdb
sdf file: 707413.sdf
directory: 707413

109377-04-0 DAMCK DAMK Glycinamide, L-tyrosyl-D-alanyl-N-(3-chloro-2-oxo-1-(phenylmethyl)propyl)-N-methyl-, (S)- Tyr-ala-gly-N(alpha)-mephe-chloromethyl ketone Tyr-ala-gly-mephe chloromethyl ketone Tyr-ala-gly-mephe-cmk Tyrosyl-alanyl-glycyl-N(alpha)-methylphenylalanine chloromethyl ketone Tyrosyl-alanyl-glycyl-methylphenylalanyl chloromethyl ketone

pdb file: 707477.pdb
sdf file: 707477.sdf
directory: 707477

(2S-(2R*,4R*,5R*))-N-(N-(6-Cyclohexyl-4-hydroxy-2-(1-methylethyl)-1-oxo-5-((N-(N-(1-(N2-(N2-((phenylmethoxy)carbonyl)-L-arginyl)-L-arginyl)-L-prolyl)-L-phenylalanyl)-L-valyl)amino)hexyl)-1-valyl)-L-tyrosine methyl ester 128856-81-5 Cgp 44 099 Cgp 44099 L-Tyrosine, N-(N-(6-cyclohexyl-4-hydroxy-2-(1-methylethyl)-1-oxo-5-((N-(N-(1-(N2-(N2-((phenylmethoxy)carbonyl)-L-arginyl)-L-arginyl)-L-prolyl)-L-phenylalanyl)-L-valyl)amino)hexyl)-1-valyl)-, methyl ester, (2S-(2R*,4R*,5R*))-

pdb file: 707491.pdb
sdf file: 707491.sdf
directory: 707491

(R-(R*,S*))-N-((Phenylmethoxy)carbonyl)-L-alanyl-N-(1-(hydroxy(2-methoxy-2-oxo-1-(phenylmethyl)ethoxy)phosphinyl)-3-methylbutyl)-L-alaninamide 128901-55-3 Benzyloxycarbonylalanyl-alanyl-leucyl phosphinate-3-phenyllactic acid methyl ester Cbz-ala-ala-leu(P)-(O)-phe-ome Cbzaal(P)(O)fome L-Alaninamide, N-((phenylmethoxy)carbonyl)-L-alanyl-N-(1-(hydroxy(2-methoxy-2-oxo-1-(phenylmethyl)ethoxy)phosphinyl)-3-methylbutyl)-, (R-(R*,S*))-

pdb file: 707496.pdb
sdf file: 707496.sdf
directory: 707496

(S)-L-Arginylglycyl-N-(17-(2-amino-2-oxoethyl)-20-(2,4-dihydroxyphenyl)-8,16,19-trioxo-5,9,15,18-tetraazaeicos-1-yl)-L-alaninamide 129121-68-2 Clavamin Clavamine L-Alaninamide, L-arginylglycyl-N-(17-(2-amino-2-oxoethyl)-20-(2,4-dihydroxyphenyl)-8,16,19-trioxo-5,9,15,18-tetraazaeicos-1-yl)-, (S)- N-(2,4-Dihydroxyphenylacetyl-L-asparaginyl)-N'-(N-(L-arginyl-glycyl-L-alanyl)-8-amino-4-azaoctanoyl)-1,5-pentanediamine

pdb file: 707526.pdb
sdf file: 707526.sdf
directory: 707526

1-Niclys-3-(3-pal)-5-Cl2Phe-6-asn-7,9-trp-11-nle-substance P 1-Nicotinyl-lysyl-3-pyridyl-alanyl-5-dichloro-phenylalanyl-6-asparaginyl-7,9-tryptophyl-11-norleucine-substance P 129176-97-2 L-Norleucinamide, N6-(3-pyridinylcarbonyl)-D-lysyl-L-prolyl-3-(3-pyridinyl)-L-alanyl-L-prolyl-3,4-dichloro-D-phenylalanyl-L-asparaginyl-D-tryptophyl-L-phenylalanyl-D-tryptophyl-L-leucyl- L-Norleucinamide, N6-(3-pyridinylcarbonyl)-D-lysyl-L-propyl-3-(3-pyridinyl)-L-alanyl-L-propyl-3,4-dichloro-D-phenylalanyl-L-asparaginyl-D-tryptophyl-L-phenylalanyl-D-tryptophyl-L-leucyl- N6-(3-Pyridinylcarbonyl)-D-lysyl-L-propyl-3-(3-pyridinyl)-L-alanyl-L-propyl-3,4-dichloro-D-phenylalanyl-L-asparaginyl-D-tryptophyl-L-phenylalanyl-D-tryptophyl-L-leucyl-L-norleucinamide Npcatn-SP Spantide II Substance P, nic-lys(1)-3-pal(3)-Cl2-phe(5)-asn(6)-trp(7,9)-nle(11)- Substance P, nicotinyllysyl(1)-3-pyridylalanyl(3)-dichlorophenyl(5)-asparaginyl(6)-tryptophyl(7,9)-norleucine-

pdb file: 707533.pdb
sdf file: 707533.sdf
directory: 707533

129219-63-2 L-Phenylalaninamide, N-(3-carboxy-1-oxopropyl)-L-phenylalanyl-L-leucyl-N-(methoxynaphthalenyl)- N-(3-Carboxy-1-oxopropyl)-L-phenylalanyl-L-leucyl-N-(methoxynaphthalenyl)-L-phenylalaninamide Splpmna Suc-phe-leu-phe-mna Succinyl-phenylalanyl-leucyl-phenylalanine-4-methoxynaphthylamide

pdb file: 707538.pdb
sdf file: 707538.sdf
directory: 707538

(Arg(6),trp(7,9),N-mephe(8))-substance P(6-11) 129244-81-1 6-Arg-7,9-trp-8-Me-phe-substance P (6-11) 6-Arginyl-7,9-tryptophyl-8-methylphenylalanine-substance P (6-11) AntG Arg(6)-D-trp(7,9)-mephe(8)-SP(6-11) L-Methioninamide, L-arginyl-D-tryptophyl-4-methyl-L-phenylalanyl-D-tryptophyl-L-leucyl- SP-Ant Substance P (6-11), arg(6)-trp(7,9)-Me-phe(8)- Substance P (6-11), arginyl(6)-tryptophyl(7,9)-methylphenylalanine(8)-

pdb file: 707545.pdb
sdf file: 707545.sdf
directory: 707545

(S-(R*,R*))-N-(3-Methyl-1-oxobutyl)-L-phenylalanyl-N-(1-(cyclohexylmethyl)-2-hydroxy-5-(2-pyridinyl)pentyl)-L-histidinamide 130024-92-9 L-Histidinamide, N-(3-methyl-1-oxobutyl)-L-phenylalanyl-N-(1-(cyclohexylmethyl)-2-hydroxy-5-(2-pyridinyl)pentyl)-, (S-(R*,R*))- S 863390 S-863390

pdb file: 707589.pdb
sdf file: 707589.sdf
directory: 707589

1,2-Dithiolan-4-ol, 3,3'-(1-methyl-2,5-pyrrolidinediyl)bis-, (2R-(2alpha(3S*,4S*),5beta(3S*,4S*)))- 11010-54-1 14022-19-6 Bis-1,2-dithioalanylpyrrolidine Gerrardine

pdb file: 707621.pdb
sdf file: 707621.sdf
directory: 707621

130333-59-4 Ac-4-Nle-5-glu(gbh)-7-phe-alpha-msh(4-10)-NH2 Glycinamide, N-acetyl-L-norleucyl-N-(4-hydroxyphenyl)-L-glutaminyl-L-histidyl-D-phenylalanyl-L-arginyl-L-tryptophyl- N-Acetyl-L-norleucyl-N-(4-hydroxyphenyl)-L-glutaminyl-L-histidyl-D-phenylalanyl-L-arginyl-L-tryptophylglycinamide Ngp-msh alpha-Msh (4-10)NH2, Ac-nle(4)-glu(gamma-4'-hydroxyanilide)(5)-phe(7)- alpha-Msh (4-10)amide, acetyl-norleucyl(4)-glutamic acid(gamma-4'-hydroxyanilide)(5)-phenylalanine(7)-

pdb file: 707641.pdb
sdf file: 707641.sdf
directory: 707641

130378-94-8 Alanine, N-((1,1-dimethylethoxy)carbonyl)-L-valyl-L-alanyl-L-leucyl-2-methylalanyl-L-valyl-L-alanyl-L-leucyl-L-valyl-L-alanyl-L-leucyl-2-methylalanyl-L-valyl-L-alanyl-L-leucyl-2-methyl-, methyl ester Boc-val-ala-leu-aib-val-ala-leu-(val-ala-leu-aib)(2) methyl ester Boc-vala methyl ester N-tert-Butyloxycarbonyl-valyl-alanyl-leucyl-aminoisobutyryl-valyl-alanyl-leucyl(valyl-alanyl-leucyl-aminoisobutyryl)(2) methyl ester

pdb file: 707653.pdb
sdf file: 707653.sdf
directory: 707653

130447-82-4 Farnesyl-larykc Farnesyl-leu-ala-arg-tyr-lys-cys Farnesylleucyl-alanyl-arginyl-tyrosyl-lysyl-cysteine

pdb file: 707662.pdb
sdf file: 707662.sdf
directory: 707662

76932-83-7 L-Phenylalaninamide, L-tyrosyl-D-tryptophyl-L-alanyl-D-tryptophyl- L-Tyrosyl-D-tryptophyl-L-alanyl-D-tryptophyl-L-phenylalaninamide Ttatpn Tyr-trp-ala-trp-phe-NH2 Tyrosyl-tryptophyl-alanyl-tryptophyl-phenylalaninamide

pdb file: 707737.pdb
sdf file: 707737.sdf
directory: 707737

2-Arg-5-leu-enkephalin 76939-27-0 D-Arg(2)-leu(5)-enkephalin Enkephalin, arg(2)-leu(5)- L-Leucine, N-(N-(N-(N2-L-tyrosyl-D-arginyl)glycyl)-L-phenylalanyl)- Leucine-enkephalin, arg(2)-

pdb file: 707738.pdb
sdf file: 707738.sdf
directory: 707738

131167-89-0 IKVAV Ile-lys-val-ala-val Isoleucyl-lysyl-valyl-alanyl-valine L-Valine, N-(N-(N-(N(2)-L-isoleucyl-L-lysyl)-L-valyl)-L-alanyl)- N-(N-(N-(N(2)-L-Isoleucyl-L-lysyl)-L-valyl)-L-alanyl)-L-valine

pdb file: 707770.pdb
sdf file: 707770.sdf
directory: 707770

131374-22-6 L-Phenylalanine, N-(1-(N-(N-(4-methoxy-1,4-dioxobutyl)-L-alanyl)-L-alanyl)-L-prolyl)-, methyl ester Mdl 27,399 Mdl 27399 Meo-succ-ala-ala-pro-phe-cooch3

pdb file: 707793.pdb
sdf file: 707793.sdf
directory: 707793

(2R-(2alpha,3beta,4alpha(R*),5beta))-N2-(N-(2-((5-(Acetylamino)-3-hydroxy-2-(hydroxymethyl)-4-piperidinyl)oxy)-1-oxopropyl)-L-alanyl)-D-alpha-glutamine 131432-97-8 Atiglai D-alpha-Glutamine, N2-(N-(2-((5-(acetylamino)-3-hydroxy-2-(hydroxymethyl)-4-piperidinyl)oxy)-1-oxopropyl)-L-alanyl)-, (2R-(2alpha,3beta,4alpha(R*),5beta))-, mono(trifluoroacetate) (salt) N-(2-O-(2-Acetamido-1,2,3,5-tetradeoxy-1,5-imino-D-glucitol-3-yl)-D-lactoyl)-L-alanyl-D-isoglutamine N-(2-O-(2-Acetamido-1,2,3,5-tetradeoxy-1,5-iminoglucitol-3-yl)lactoyl)alanyl-isoglutamine N2-(N-(2-((5-(Acetylamino)-3-hydroxy-2-(hydroxymethyl)-4-piperidinyl)oxy)-1-oxopropyl)-L-alanyl)-D-alpha-Glutamine (2R-(2alpha,3beta,4alpha(R*),5beta))-, mono(trifluoroacetate) (salt)

pdb file: 707801.pdb
sdf file: 707801.sdf
directory: 707801

131766-24-0 BUBUC L-Threonine, N-(N-(N-(N-(S-(1,1-dimethylethyl)-N-L-tyrosyl-D-cysteinyl)glycyl)-L-phenylalanyl)-L-leucyl)-, 1,1-dimethylethyl ester Tyr-cys-(stbu)-gly-phe-leu-thr(otbu) Tyrosyl-cysteinyl(stbu)-glycyl-phenylalanyl-leucyl-threonyl(O-t-butyl)

pdb file: 707835.pdb
sdf file: 707835.sdf
directory: 707835

132031-83-5 L-Phenylalanine, 4-(methylsulfinyl)-L-2-aminobutanoyl-L-alpha-glutamyl-L-histidyl-L-phenylalanyl-D-lysyl-, 6-decyl ester Met-O2-glu-his-phe-D-lys-phe-O-(CH2)9-CH3 Org 31433 Org-31433

pdb file: 707875.pdb
sdf file: 707875.sdf
directory: 707875

132041-94-2 Asp-ser-phe-phe-beta-ala-leu-met-NH2 Aspartyl-seryl-phenylalanyl-phenylalanyl-beta-alanyl-leucyl-methioninamide L-Methioninamide, L-alpha-aspartyl-L-seryl-L-phenylalanyl-L-phenylalanyl-beta-alanyl-L-leucyl- L-alpha-Aspartyl-L-seryl-L-phenylalanyl-L-phenylalanyl-beta-alanyl-L-leucyl-L-methioninamide R 487 R-487

pdb file: 707880.pdb
sdf file: 707880.sdf
directory: 707880

11,8-Metheno-1H-pyrrolo(1,2-f)(1,3,6,9,12)pentaazacyclopentadecine-6-carboxylic acid, 2,3,4,5,6,7,12,13,15,16,17,17a-dodecahydro-1,4,13-trioxo-3-(phenylmethyl)-, (3S-(3R*,6R*,17aR*))- 132235-85-9 Ccmpph Cyclic(3-1)-1-(carboxymethyl)prolyl-phenylalanyl-histidinamide Cyclo(CM-pro-phe-his-NH2)

pdb file: 707908.pdb
sdf file: 707908.sdf
directory: 707908

132247-17-7 Boc-beta-cyano-L-ala-L-pro-obzl Boc-capobzl t-Butyloxycarbonyl-cyanoalanylproline benzyl ester

pdb file: 707909.pdb
sdf file: 707909.sdf
directory: 707909

132472-84-5 2-Aminobenzoyl-glycyl-glycyl-phenylalanyl-leucyl-arginyl-arginyl-valyl-N-(2,4-dinitrophenyl)ethylenediamine Abz-G-G-F-L-R-R-V-eddn Abz-gly-gly-phe-leu-arg-arg-val-eddn L-Valinamide, N-(2-aminobenzoyl)glycylglycyl-L-phenylalanyl-L-leucyl-L-arginyl-L-arginyl-N-(2-((2,4-dinitrophenyl)amino)ethyl)- N-(2-Aminobenzoyl)glycylglycyl-L-phenylalanyl-L-leucyl-L-arginyl-L-arginyl-N-(2-((2,4-dinitrophenyl)amino)ethyl)-L-valinamide QF-Erp7

pdb file: 707927.pdb
sdf file: 707927.sdf
directory: 707927

132748-20-0 Ac-Ser-leu-asn-phe-psi(CH(OH)CH2N)-pro-ile-val-ome Acetyl-seryl-leucyl-asparaginyl-phenylalanyl-psi-(2-hydroxy-1-ethylamine)-prolyl-isoleucyl-valine-methoxy JG 365 JG-365 L-Valine, N-(N-(1-(3-((N2-(N-(N-acetyl-L-seryl)-L-leucyl)-L-asparaginyl)amino)-2-hydroxy-4-phenylbutyl)-L-prolyl)-L-isoleucyl)-, methyl ester

pdb file: 707955.pdb
sdf file: 707955.sdf
directory: 707955

1-Tyr-psi-(methyleneoxy)-2-gly-5-leu-enkephalinamide 133851-90-8 Enkephalinamide, tyr(1)-psi-(methyleneoxy)-gly(2)-leu(5)- Enkephalinamide, tyrosyl(1)-psi-(methylenoxy)-glycyl(2)-leucine(5)- L-Leucinamide, N-((2-amino-3-(4-hydroxyphenyl)propoxy)acetyl)glycyl-L-phenylalanyl-, (S)- Tyr-(CH2O)-gly-leu-EK

pdb file: 708077.pdb
sdf file: 708077.sdf
directory: 708077

134283-52-6 Alpatp Fahx-leu-phe-ahx-tyr-phe Formyl-aminohexyl-leucyl-phenylalanyl-aminohexyl-tyrosyl-phenylalanine

pdb file: 708115.pdb
sdf file: 708115.sdf
directory: 708115

2-Ala-4-Cl-phe-leu-enkephalin 2-Alanyl-4-chlorophenyalanyl-leucine enkephalin 77062-77-2 D-Leucine, L-tyrosyl-D-alanylglycyl-4-chloro-L-phenylalanyl- Enkephalin-leu, (ala(2)-Cl-phe(4))- LEACP Leu-enkephalin, ala(2)-Cl-phe(4)- Leucine enkephalin-2-alanyl-4-chlorophenylalanine

pdb file: 708132.pdb
sdf file: 708132.sdf
directory: 708132

134439-73-9 Gfnsalmfamide Gly-phe-asn-ser-ala-leu-met-phe-NH2 Glycyl-L-phenylalanyl-L-asparaginyl-L-seryl-L-alanyl-L-leucyl-L-methionyl-L-phenylaninamide L-Phenylaninamide, glycyl-L-phenylalanyl-L-asparaginyl-L-seryl-L-alanyl-L-leucyl-L-methionyl- Neuropeptide S1 Salmfamide 1

pdb file: 708175.pdb
sdf file: 708175.sdf
directory: 708175

134439-74-0 L-Phenylalaninamide, L-serylglycyl-L-prolyl-L-tyrosyl-L-seryl-L-phenylalanyl-L-asparaginyl-L-serylglycyl-L-leucyl-L-threonyl- Neuropeptide S2 Salmfamide 2 Ser-gly-pro-tyr-ser-phe-asn-ser-gly-leu-thr-phe-NH2 Sgpysfnsgltfamide

pdb file: 708176.pdb
sdf file: 708176.sdf
directory: 708176

(1S-(1R*,2S*,3R*))-N-(4-Morpholinylsulfonyl)-L-phenylalanyl-N-(1-(cyclohexylmethyl)-2,3-dihydroxy-5-methylhexyl)-O-methyl-3-oxo-L-serinamide 134452-04-3 3-((1-(Cyclohexylmethyl)-2,3-dihydroxy-5-methylhexyl)amino)-N-(N-(4-morpholinosulfonyl)phenylalanyl)-3-oxo-DL-alanine methyl ester L-Serinamide, N-(4-morpholinylsulfonyl)-L-phenylalanyl-N-(1-(cyclohexylmethyl)-2,3-dihydroxy-5-methylhexyl)-O-methyl-3-oxo-, (1S-(1R*,2S*,3R*))- PD 132002 PD-132002

pdb file: 708178.pdb
sdf file: 708178.sdf
directory: 708178

134876-52-1 3-(2-Furylacryloyl)phenylalanylleucine FA-Phe-leu

pdb file: 708211.pdb
sdf file: 708211.sdf
directory: 708211

135014-49-2 Ftrfamide L-Phenylalaninamide, L-phenylalanyl-L-threonyl-L-arginyl- Phe-thr-arg-phe-NH2 Phenylalanyl-threonyl-arginyl-phenylalaninamide

pdb file: 708229.pdb
sdf file: 708229.sdf
directory: 708229

135704-06-2 CI 992 CI-992 L-Alaninamide, N-(4-morpholinylsulfonyl)-L-phenylalanyl-3-(2-amino-4-thiazolyl)-N-((1S,2R,3S)-1-(cyclohexylmethyl)-2,3-dihydroxy-5-methylhexyl)- N-(4-Morpholinylsulfonyl)-L-phenylalanyl-3-(2-amino-4-thiazolyl)-N-((1S,2R,3S)-1-(cyclohexylmethyl)-2,3-dihydroxy-5-methylhexyl)-L-alaninamide N-(4-Morpholinylsulfonyl)-L-phenylalanyl-3-(2-amino-4-thiazolyl)-N-(1-(cyclohexylmethyl)-2,3-dihydroxy-5-methylhexyl)-L-alaninamide

pdb file: 708287.pdb
sdf file: 708287.sdf
directory: 708287

135788-75-9 Alanine, 2-methyl-N-(2-methyl-N-(-N-((phenylmethoxy)carbonyl)-L-isoleucyl)-L-alanyl)-, methyl ester Benzyloxycarbonyl-isoleucyl-alanyl-alpha-aminoisobutyryl-alpha-aminoisobutyrate methyl ester Z-Ile-ala-aib-ome

pdb file: 708293.pdb
sdf file: 708293.sdf
directory: 708293

136639-71-9 Ac-Nal(2)-4-Cl-phe-trp-ser-tyr-ser(rha)-leu-arg-pro-azgly-NH2 Hoe 013 L-Proline, 1-(N2-(N-(N-(N-(N-(N-(N-(N-acetyl-3-(1-naphthalenyl)-D-alanyl)-4-chloro-D-phenylalanyl)-D-tryptophyl)-L-seryl)-L-tyrosyl)-O-(6-deoxy-alpha-L-mannopyranosyl)-D-seryl)-L-leucyl)-L-arginyl)-, 2-(aminocarbonyl)hydrazide Ramorelix

pdb file: 708358.pdb
sdf file: 708358.sdf
directory: 708358

136912-73-7 GR 51667 GR-51667 L-Methionine, N-(N-(1-(N-(N-(5-amino-1-oxopentyl)-L-phenylalanyl)-L-phenylalanyl)-D-prolyl)-L-leucyl)- Substance P (7-11), delta-ava-pro(9)- Substance P (7-11). delta-aminovalyl-pro(9)- delta-Ava-pro(9)-substance P (7-11)

pdb file: 708380.pdb
sdf file: 708380.sdf
directory: 708380

137015-76-0 L-Aspartamide, N-((1-aminocyclohexyl)carbonyl)-L-phenylalanyl-N1-(2-hydroxy-6-methyl-4-(((2-methylpropyl)amino)carbonyl)-1-(phenylmethyl)heptyl)-, monohydrochloride, (1S-(1R*,2R*,4S*))- N-Isopentyl 5-(1-aminocyclohexylcarbonyl-phe-asn-amino)-4-hydroxy-2-isobutyl-6-phenylhexanamide N-Isopentyl-5-(1-aminocyclohexylcarbonyl-phenylalanyl-asparaginylamino)-4-hydroxy-2-isobutyl-6-phenylhexanamide UK 88947 UK-88,947

pdb file: 708387.pdb
sdf file: 708387.sdf
directory: 708387

137132-73-1 L-Lysine, N2-(1-(N2-(N2-(N-L-valyl-L-alanyl)-L-lysyl)-L-lysyl)-L-prolyl)- N2-(1-(N2-(N2-(N-L-Valyl-L-alanyl)-L-lysyl)-L-lysyl)-L-prolyl)-L-lysine P23 Sperm acrosomal peptide Sperm acrosomal peptide P23 Val-ala-lys-lys-pro-lys

pdb file: 708406.pdb
sdf file: 708406.sdf
directory: 708406

137182-25-3 Fulicin L-Valinamide, L-phenylalanyl-D-asparaginyl-L-alpha-glutamyl-L-phenylalanyl- Phe-asn-glu-phe-val-NH2 Phenylalanyl-asparaginyl-glutamyl-phenylalanyl-valinamide

pdb file: 708408.pdb
sdf file: 708408.sdf
directory: 708408

137233-78-4 L-Lysine, N6-(N-(bromoacetyl)-beta-alanyl)-N2-((1,1-dimethylethoxy)carbonyl)- N-Bbal N-alpha-(tert-Butoxycarbonyl)-N-epsilon-(N-(bromoacetyl)-beta-alanyl)-L-lysine Nalpha-(tert-butoxycarbonyl)-nepsilon-(N-(bromoacetyl)alanyl)lysine

pdb file: 708414.pdb
sdf file: 708414.sdf
directory: 708414

137350-94-8 3-Phenyllactyl-phenylalanyl-lysyl-alaninamide Antho-kaamide L-3-Phenyllactyl-phe-lys-ala-NH2 L-Alaninamide, N-(2-hydroxy-1-oxo-3-phenylpropyl)-L-phenylalanyl-L-lysyl-, (S)-

pdb file: 708423.pdb
sdf file: 708423.sdf
directory: 708423

137372-36-2 L-Proline, 1-(N-(N-(1-(N-L-tyrosylglycyl)-L-prolyl)-L-leucyl)-L-phenylalanyl)- Tgplpp Tyr-gly-pro-leu-phe-pro Tyrosyl-glycyl-prolyl-leucyl-phenylalanyl-proline

pdb file: 708426.pdb
sdf file: 708426.sdf
directory: 708426

137372-37-3 L-Proline, 1-(N-(N-(1-(N-L-tyrosyl-L-valyl)-L-prolyl)glycyl)-L-phenylalanyl)- Tvpgpp Tyr-val-pro-gly-phe-pro Tyrosyl-valyl-prolyl-glycyl-phenylalanyl-proline

pdb file: 708427.pdb
sdf file: 708427.sdf
directory: 708427

137372-38-4 L-Proline, 1-(N-(N-(1-(N-L-tyrosylglycyl)-L-prolyl)glycyl)-L-phenylalanyl)- Tgpgpp Tyr-gly-pro-gly-phe-pro Tyrosyl-glycyl-prolyl-glycyl-phenylalanyl-proline

pdb file: 708428.pdb
sdf file: 708428.sdf
directory: 708428

(3R-(1(S*(S*)),3R*))-L-Lysyl-L-alpha-aspartyl-L-seryl-L-phenylalanyl-N-(1-(1-(((1-(aminocarbonyl)-3-(methylthio)propyl)amino)carbonyl)-3-methylbutyl)-2-oxo-3-pyrrolidinyl)-L-valinamide 136218-59-2 136548-07-7 137593-52-3 3-Lys-8-gly-R-lactam-9-leu-neurokinin A (3-10) GR 64349 GR-64349 L-Valinamide, L-lysyl-L-alpha-aspartyl-L-seryl-L-phenylalanyl-N-(1-(1-(((1-(aminocarbonyl)-3-(methylthio)propyl)amino)carbonyl)-3-methylbutyl)-2-oxo-3-pyrrolidinyl)-, (3R-(1(S*(S*)),3R*))- Neurokinin A (3-10), lys(3)-gly(8)-R-lactam-leu(9)- Neurokinin A (3-10), lysyl(3)-glycyl(8)-R-lactam-leucine(9)-

pdb file: 708453.pdb
sdf file: 708453.sdf
directory: 708453

137623-46-2 4-Tgpap N(alpha)-(4-Toluenesulfonyl)-4-guanidinophenylalanylpiperidine Piperidine, 1-(3-(4-((aminoiminomethyl)amino)phenyl)-2-(((4-methylphenyl)sulfonyl)amino)-1-oxopropyl)-, (+-)-

pdb file: 708455.pdb
sdf file: 708455.sdf
directory: 708455

138079-74-0 Benzoyl-alanyl-thioglycolate Benzoyl-alanyl-thioglycolic acid Bz-Ala-SG

pdb file: 708482.pdb
sdf file: 708482.sdf
directory: 708482

138107-58-1 L-Phenylalanine, N-(N-(N-(4-(aminoiminomethyl)benzoyl)-beta-alanyl)-L-alpha-aspartyl)- N-(N-(N-(p-Amidinobenzoyl)-beta-alanyl)-L-alpha-aspartyl)-3-phenyl-L-alanine Ro 43-5054 Ro 435054 p-Amidinobenzoyl-beta-alanyl-aspartyl-phenylalanine

pdb file: 708484.pdb
sdf file: 708484.sdf
directory: 708484

138109-95-2 Day8Ra Desamino-tyr-phe-leu-phe-gln-pro-gln-arg-NH2 Desamino-tyrosyl-phenylalanyl-leucyl-phenylalanyl-glutaminyl-prolyl-glutaminyl-argininamide Desaminoyflfqpqramide L-Argininamide, N-(3-(4-hydroxyphenyl)-1-oxopropyl)-L-phenylalanyl-L-leucyl-L-phenylalanyl-L-glutaminyl-L-prolyl-L-glutaminyl- N-(3-(4-Hydroxyphenyl)-1-oxopropyl)-L-phenylalanyl-L-leucyl-L-phenylalanyl-L-glutaminyl-L-prolyl-L-glutaminyl-L-argininamide

pdb file: 708485.pdb
sdf file: 708485.sdf
directory: 708485

138228-38-3 L-Tyrosyl-D-arginyl-L-phenylalanyl-beta-alaninamide Tapa-beta Tyr-arg-phe-beta-ala-NH2 Tyrosyl-arginyl-phenylalanyl-beta-alaninamide beta-Alaninamide, L-tyrosyl-D-arginyl-L-phenylalanyl-

pdb file: 708498.pdb
sdf file: 708498.sdf
directory: 708498

138474-03-0 CM 2-3 Glycine, N-(1-(N-((1-(2-amino-3-(4-hydroxyphenyl)-1-oxopropyl)-2-pyrrolidinyl)methyl)-L-phenylalanyl)-L-prolyl)-, (S-(R*,R*))- Tyr-pro-psi(CH2-NH)-phe-pro-gly Tyrosyl-prolyl-psi(methylamino)-phenylalanyl-prolyl-glycine

pdb file: 708518.pdb
sdf file: 708518.sdf
directory: 708518

138571-29-6 APCMN L-Norleucinamide, N-acetyl-L-phenylalanyl-N-(4-((butylamino)carbonyl)-1-(cyclohexylmethyl)-2-hydroxy-5-methylhexyl)-, (1S-(1R*,2R*,4R*))- N-Acetylphenylalanyl-N-(4-((butylamino)carbonyl)-1-(cyclohexylmethyl)-2-hydroxy-5-methylhexyl)norleucinamide

pdb file: 708524.pdb
sdf file: 708524.sdf
directory: 708524

10-Desarg-hoe 140 138680-92-9 Arg-(3-hyp-5-thi-7-tic-9-oic)-9-desarg-bradykinin Bradykinin, arg-(hyp(3)-thi(5)-tic(7)-oic(8))-desarg(9)- Bradykinin, arginyl-(hydroxypropyl(3)-3-thienylalanyl(5)-1,2,3,4-tetrahydro-3-isoquinolinecarbonyl(7)-octahydro-1H-indole-2-carbonyl(8))-desarginyl(9)- D-Arg(hyp(3)-thi(5)-D-tic(7)-oic(8)-desarg(10))BK Darg(hyp(3)-thi(5)-dtic(7)-oic(8))desarg(9)-BK Hoe 140, desarg(10)- Hoe 140, desarginyl(10)- L-Alaninamide, D-arginyl-L-arginyl-L-prolyl-trans-4-hydroxy-L-prolylglycyl-N-(2-(3-((2-carboxyoctahydro-1H-indol-1-yl)carbonyl)-3,4-dihydro-2(1H)-isoquinolinyl)-1-(hydroxymethyl)-2-oxoethyl)-3-(2-thienyl)-, (2S-(1(S*(R*)),2alpha,3abeta,7abeta))-

pdb file: 708543.pdb
sdf file: 708543.sdf
directory: 708543

138749-62-9 24-Ala-grp(20-26) Gastrin releasing peptide (20-26), ala(24)- Gastrin-releasing peptide (20-26), alanyl(24)- His-trp-ala-val-ala-his-leu L-Leucine, N-(N-(N-(N-(N-(N-L-histidyl-L-tryptophyl)-L-alanyl)-L-valyl)-D-alanyl)-L-histydyl)-

pdb file: 708544.pdb
sdf file: 708544.sdf
directory: 708544

139113-32-9 Ala-thr-met-arg-tyr-pro-ser-asp-asp-ser-glu Alanyl-threonyl-methionyl-arginyl-tyrosyl-prolyl-seryl-aspartyl-aspartyl-seryl-glutamine L-Glutamic acid, N-(N-(N-(N-(N-(1-(N-(N2-(N-(N-L-alanyl-L-threonyl)-L-methionyl)-L-arginyl)-L-tyrosyl)-L-prolyl)-L-seryl)-L-alpha-aspartyl)-L-alpha-aspartyl)-L-seryl)- Marinostatin D

pdb file: 708565.pdb
sdf file: 708565.sdf
directory: 708565

139113-49-8 L-Norleucinamide, N-((1,1-dimethylethoxy)carbonyl)-L-phenylalanyl-N-(1-(cyclohexylmethyl)-2-hydroxy-3-((phenylmethyl)amino)propyl)-, (R-(R*,S*))- SQ 32,056 SQ 32056

pdb file: 708566.pdb
sdf file: 708566.sdf
directory: 708566

139146-66-0 L-Cysteine, N-(2,2-dimethyl-3-(nitrooxy)-1-oxopropyl)-, ethyl ester, ester with N-acetyl-L-alanine N-Nitratopivaloyl-S-(N'-acetylalanyl)-cysteine ethyl ester Spm 5185 Spm-5185

pdb file: 708571.pdb
sdf file: 708571.sdf
directory: 708571

139890-66-7 CH 66 CH-66 L-Serinamide, N-(2-((N-(1-(N-(2,2-dimethyl-1-oxopropyl)-L-histidyl)-L-prolyl)-phenylalanyl)amino)-1-hydroxy-4-methylpentyl)-L-leucyl-L-tyrosyl-L-tyrosyl- Piv-his-pro-phe-leu(OH)leu-tyr-tyr-ser-NH2

pdb file: 708614.pdb
sdf file: 708614.sdf
directory: 708614

141311-86-6 Ac-Ala-ala-gln-lys-arg-pro-ser-gln-arg-ser-lys-tyr-amide Acetyl-alanyl-alanyl-glutaminyl-lysyl-arginyl-prolyl-seryl-glutaminyl-arginyl-seryl-lysyl-tyrosinamide L-Tyrosinamide, N-acetyl-L-alanyl-L-alanyl-L-glutaminyl-L-lysyl-L-arginyl-L-prolyl-L-seryl-L-glutaminyl-L-arginyl-L-seryl-L-lysyl- Mpa-12 Myelin peptide amide-12

pdb file: 708689.pdb
sdf file: 708689.sdf
directory: 708689

141363-42-0 L-Lysine, N2-(N2-(N-(N2-(N2-L-lysyl-L-arginyl)-L-arginyl)-L-phenylalanyl)-L-lysyl)- Lys-arg-arg-phe-lys-lys Lysyl-arginyl-arginyl-phenylalanyl-lysyl-lysine SQ 32429 SQ-32429

pdb file: 708696.pdb
sdf file: 708696.sdf
directory: 708696

141627-61-4 GD-6 Peptide L-Arginine, L-lysyl-L-glutaminyl-L-asparaginyl-L-cysteinyl-L-leucyl-L-seryl-L-seryl-L-arginyl-L-alanyl-L-seryl-L-phenylalanyl-L-arginylglycyl-L-cysteinyl-L-valyl-L-arginyl-L-asparaginyl-L-leucyl-L-arginyl-L-leucyl-L-seryl- L-Lysyl-L-glutaminyl-L-asparaginyl-L-cysteinyl-L-leucyl-L-seryl-L-seryl-L-arginyl-L-alanyl-L-seryl-L-phenylalanyl-L-arginylglycyl-L-cysteinyl-L-valyl-L-arginyl-L-asparaginyl-L-leucyl-L-arginyl-L-leucyl-L-seryl-L-arginine Laminin-derived peptide, GD-6

pdb file: 708711.pdb
sdf file: 708711.sdf
directory: 708711

141636-65-9 GR 94800 GR-94800 L-Norleucinamide, N-benzoyl-L-alanyl-L-alanyl-D-tryptophyl-L-phenylalanyl-D-prolyl-L-prolyl- N-alpha-Benzoylalanyl-alanyl-tryptophyl-phenylalanyl-prolyl-prolyl-norleucinamide Nalpha-Benzoyl-ala-ala-D-trp-phe-D-pro-pro-nle-NH2

pdb file: 708712.pdb
sdf file: 708712.sdf
directory: 708712

141839-61-4 Bim 22015 Bim-22015 Glycinamide, D-alanyl-L-glutaminyl-L-tyrosyl-L-phenylalanyl-L-arginyl-L-tryptophyl-, acetate

pdb file: 708720.pdb
sdf file: 708720.sdf
directory: 708720

141925-59-9 Ala-his-D-beta-nal-ala-trp-D-phe-lys-NH2 Alanyl-histidyl-(2-naphthyl)alanyl-tryptophyl-phenylalanyl-lysinamide GHRP 1 Ghrp-1 Growth hormone-releasing peptide 1 KP 101 L-Lysinamide, L-alanyl-L-histidyl-3-(2-naphthalenyl)-D-alanyl-L-alanyl-L-tryptophyl-D-phenylalanyl-

pdb file: 708735.pdb
sdf file: 708735.sdf
directory: 708735

141949-00-0 Azidophenylalanyl-cysteinyl-tyrosyl-tryptophyl-lysyl-threonyl-cysteinyl-threonin-ol EE 581 EE-581 L-Cysteinamide, 4-azido-D-phenylalanyl-L-cysteinyl-L-tyrosyl-D-tryptophyl-L-lysyl-L-threonyl-N-(2-hydroxy-1-(hydroxymethyl)propyl)-, cyclic (2-7)-disulfide, (R-(R*,R*))- Phe(N3)-cys-tyr-trp-lys-thr-cys-thr-ol

pdb file: 708736.pdb
sdf file: 708736.sdf
directory: 708736

142191-57-9 L-Phenylalaninamide, L-lysyl-L-valyl-L-valyl-L-histidyl-L-leucyl-L-arginyl-L-prolyl-L-arginyl-L-seryl-L-seryl-L-phenylalanyl-L-seryl-L-seryl-L-alpha-glutamyl-L-alpha-aspartyl-L-alpha-glutamyl-L-tyrosyl-L-glutaminyl-L-isoleucyl-L-tyrosyl-L-leucyl-L-arginyl-L-asparaginyl-L-val yl-L-seryl-L-lysyl-L-tyrosyl-L-isoleucyl-L-glutaminyl-L-leucyl-L-tyrosylglycyl-L-arginyl-L-prolyl-L-arginyl- Neuropeptide F

pdb file: 708752.pdb
sdf file: 708752.sdf
directory: 708752

142606-55-1 L-Leucine, N-(N-(N-(1-(N-(1-(N-L-leucyl-L-seryl)-L-prolyl)-L-phenylalanyl)-L-prolyl)-L-phenylalanyl)-L-alpha-aspartyl)- Leucyl-seryl-prolyl-phenylalanyl-prolyl-phenylalanyl-aspartyl-leucine Lspfpfdl p2Ca Peptide p2Ca-Y4

pdb file: 708793.pdb
sdf file: 708793.sdf
directory: 708793

(125I)Sch47896 142621-29-2 N-(N-(1(5)-Carboxy-3-(4-hydroxyphenyl)propyl)-(5)-phenylalanyl)-(5)-isoserine Sch 47896 Sch-47896 beta-Alanine, N-(N-(1-carboxy-3-(4-hydroxyphenyl)propyl)-L-phenylalanyl)-2-hydroxy-, (S-(R*,R*))-

pdb file: 708797.pdb
sdf file: 708797.sdf
directory: 708797

143294-31-9 L-Serine, glycyl-L-cysteinyl-L-cysteinyl-L-cysteinyl-L-asparaginyl-L-prolyl-L-alanyl-L-cysteinylglycyl-L-prolyl-L-asparaginyl-L-tyrosylglycyl-L-cysteinylglycyl-L-threonyl-L-seryl-L-cysteinyl- alpha-Conotoxin sii

pdb file: 708872.pdb
sdf file: 708872.sdf
directory: 708872

143873-62-5 Fluoresceinthiocarbamoyl-lys-glcnac-1-4-murnac-ala-isoglutamine Fluoresceinthiocarbamoyl-lys-gmdp Fluorescent ligand, glcnac-beta1-4-mur-N-Ac-alanyl-D-isoglutamine-lysine-flutc Gmdp-lys-flutc L-Lysine, N2-(N2-(N-(N-acetyl-4-O-(2-(acetylamino)-2-deoxy-beta-D-glucopyranosyl)muramoyl)-L-alanyl)-D-alpha-glutaminyl)-N6-(((3-carboxy-4-(6-hydroxy-3-oxo-3H-xanthen-9-yl)phenyl)amino)thioxomethyl)-

pdb file: 708910.pdb
sdf file: 708910.sdf
directory: 708910

143984-57-0 Glycine, N-(1-(3-phenyl-2-((1-L-tyrosyl-L-prolyl)amino)propyl)-L-prolyl)- Tpch2NHPPG Tyr-pro-psi(CH2NH)phe-pro-gly Tyrosyl-prolyl-psi(methylamino)phenylalanyl-prolyl-glycine

pdb file: 708915.pdb
sdf file: 708915.sdf
directory: 708915

(Hyp(3)-thi(5)-dtic(7)-oic(8))desarg(9)-BK 144006-47-3 3-Hyp-5-thi-7-tic-8-oic-9-desarg-bradykinin Bradykinin, hydroxyprolyl(3)-3-thienylalanyl(5)-1,2,3,4-tetrahydro-3-isoquinolinecarbonyl(7)-octahydro-1H-indole-2-carbonyl(8)-desarginyl(9)- Bradykinin, hyp(3)-thi(5)-tic(7)-oic(8)-desarg(9)- Des(arg(1,10))-hoe 140 Hoe 140, des(arg(1,10))- Hoe 140, des(arginyl(1,10))- Httod-BK Hyp(3)-thi(5)-D-tic(7)-oic(8)-desarg(10)-BK L-Alaninamide, L-arginyl-L-prolyl-trans-4-hydroxy-L-prolylglycyl-N-(2-(3-((2-carboxyoctahydro-1H-indol-1-yl)carbonyl)-3,4-dihydro-2(1H)-isoquinolinyl)-1-(hydroxymethyl)-2-oxoethyl)-3-(2-thienyl)-, (2S-(1(S*(R*)),2alpha,3abeta,7abeta))-

pdb file: 708918.pdb
sdf file: 708918.sdf
directory: 708918

144092-28-4 L-Leucine, L-methionyl-L-leucyl-L-threonyl-L-lysyl-L-phenylalanyl-L-alpha-glutamyl-L-threonyl-L-lysyl-L-seryl-L-alanyl-L-arginyl-L-valyl-L-lysylglycyl-L-leucyl-L-seryl-L-phenylalanyl-L-histidyl-L-prolyl-L-lysyl-L-arginyl-L-prolyl-L-tryptophyl-L-isoleucyl- L-Methionyl-L-leucyl-L-threonyl-L-lysyl-L-phenylalanyl-L-alpha-glutamyl-L-threonyl-L-lysyl-L-seryl-L-alanyl-L-arginyl-L-valyl-L-lysylglycyl-L-leucyl-L-seryl-L-phenylalanyl-L-histidyl-L-prolyl-L-lysyl-L-arginyl-L-prolyl-L-tryptophyl-L-isoleucyl-L-leucine Xenin 25 Xenin-25 xenin

pdb file: 708919.pdb
sdf file: 708919.sdf
directory: 708919

144119-58-4 Ball peptide BP L-Glutamine, L-methionyl-L-alanyl-L-alanyl-L-valyl-L-alanylglycyl-L-leucyl-L-tyrosylglycyl-L-leucylglycyl-L-alpha-glutamyl-L-alpha-aspartyl-L-arginyl-L-glutaminyl-L-histidyl-L-arginyl-L-lysyl-L-lysyl- L-Methionyl-L-alanyl-L-alanyl-L-valyl-L-alanylglycyl-L-leucyl-L-tyrosylglycyl-L-leucylglycyl-L-alpha-glutamyl-L-alpha-aspartyl-L-arginyl-L-glutaminyl-L-histidyl-L-arginyl-L-lysyl-L-lysyl-L-glutamine Potassium channel inactivating peptide Shaker B ball peptide Shaker B inactivating peptide Shb inactivating peptide (BP)

pdb file: 708925.pdb
sdf file: 708925.sdf
directory: 708925

144119-83-5 L-Threonine, N-(N-(N2-(N-(N-(N-(N-(N-(N-(N-L-histidyl-L-seryl)-L-alpha-aspartyl)-L-alanyl)-L-valyl)-L-phenylalanyl)-L-threonyl)-L-alpha-aspartyl)-L-asparaginyl)-L-tyrosyl)- Vasoactive intestinal peptide (1-11) Vip (1-11)

pdb file: 708926.pdb
sdf file: 708926.sdf
directory: 708926

144304-34-7 BA-Fleely N-Bromoacetyl-phe-leu-glu-glu-leu-tyr N-Bromoacetyl-phenylalanyl-leucyl-glutamyl-glutamyl-leucyl-tyrosine

pdb file: 708937.pdb
sdf file: 708937.sdf
directory: 708937

144387-61-1 C-Terminally located anterior lobe peptide, lymnaea stagnalis Calp peptide L-Glutamamide, L-serylglycyl-L-seryl-L-alpha-aspartyl-L-tyrosyl-L-cysteinyl-L-alpha-glutamyl-L-threonyl-L-leucyl-L-lysyl-L-alpha-glutamyl-L-valyl-L-alanyl-L-alpha-aspartyl-L-alpha-glutamyl-L-tyrosyl-L-lysyl-L-isoleucyl-L-alpha-glutamyl-L-alpha-glutamyl-L-glutaminyl-L-arginyl-L-alanyl-L-alanyl-L-alpha-aspartyl-L-cysteinylglycylglycyl-L-alpha-glutamyl-L-prolyl-L-prolyl-L-asparaginyl-L-seryl-

pdb file: 708943.pdb
sdf file: 708943.sdf
directory: 708943

144398-31-2 Glt-ala-ala-phe-amc Glutaryl-alanyl-alanyl-phenylalanyl-amidomethylcoumarin L-Phenylalaninamide, N-(4-carboxy-1-oxobutyl)-L-alanyl-L-alanyl-N-(4-methyl-2-oxo-2H-1-benzopyran-7-yl)- N-(4-Carboxy-1-oxobutyl)-L-alanyl-L-alanyl-N-(4-methyl-2-oxo-2H-1-benzopyran-7-yl)-L-phenylalaninamide

pdb file: 708945.pdb
sdf file: 708945.sdf
directory: 708945

144527-25-3 Peptide tyrosine phenylalanine Tyr-ala-ile-val-ala-arg-pro-arg-phe Tyrosyl-alanyl-isoleucyl-valyl-alanyl-arginyl-prolyl-arginyl-phenylalanine

pdb file: 708953.pdb
sdf file: 708953.sdf
directory: 708953

144548-33-4 Frvf peptide H-Phe-arg-val-phe-OH Phe-arg-val-phe Phenylalanyl-arginyl-valyl-phenylalanine

pdb file: 708955.pdb
sdf file: 708955.sdf
directory: 708955

144597-19-3 4-Nitrophenyl N-(succinyl-alanyl-alanyl-prolylmethyl)-N-isopropylcarbamate Carbamic aid, (2-(1-(2-((2-(2,5-dioxo-1-pyrrolidinyl)-1-oxopropyl)amino)-1-oxopropyl)-2-pyrrolidinyl)-2-oxoethyl)(1-methylethyl)-, 4-nitrophenyl ester, (2S-(1(R*(R*)),2R*))- Pci-nsaapm p-Nitrophenyl N-(succinyl-ala-ala-pro-Me)-N-ipc

pdb file: 708961.pdb
sdf file: 708961.sdf
directory: 708961

144909-58-0 2-(N'-Acetyl-D-phe)hydroxyethyl-2'-pyridyl disulfide 2-(N'-Acetylphenylalanyl)hydroxyethyl-2'-pyridyl disulfide Aphepds D-Phenylalanine, N-acetyl-, 2-(2-pyridinyldithio)ethyl ester

pdb file: 708977.pdb
sdf file: 708977.sdf
directory: 708977

145079-47-6 Ala-thr(P)-tyr(P)-ser-ala Alanyl-phosphothreonyl-phosphotyrosyl-seryl-alanine Atptpsa

pdb file: 709004.pdb
sdf file: 709004.sdf
directory: 709004

145079-49-8 Ala-thr-tyr(P)-ser-ala Alanyl-threonyl-phosphotyrosyl-seryl-alanine Attpsa L-Alanine, N-(N-(N-(N-L-alanyl-L-threonyl)-O-phosphono-L-tyrosyl)-L-seryl)-

pdb file: 709005.pdb
sdf file: 709005.sdf
directory: 709005

145229-76-1 L-Proline, 1-(N2-(N2-(N-(N-(N-L-seryl-L-phenylalanyl)-L-leucyl)-L-leucyl)-L-arginyl)-L-asparaginyl)- Ser-phe-leu-leu-arg-asn-pro Seryl-phenylalanyl-leucyl-leucyl-arginyl-asparaginyl-proline Sfllrnp Thrombin receptor peptide sfllrnp Trp-sfllrnp

pdb file: 709017.pdb
sdf file: 709017.sdf
directory: 709017

145269-74-5 Neb-SK-I Neosulfakinin I Neosulfakinin-I Phe-asp-asp-tyr-gly-his-met-arg-phe-(NH2) Phenylalanyl-aspartyl-aspartyl-tyrosyl-glycyl-histidyl-methionyl-arginyl-phenylalaninamide

pdb file: 709019.pdb
sdf file: 709019.sdf
directory: 709019

(1DME)Y8Fa 145274-94-8 Neuropeptide FF (OX), 1-D-tyrosine-2-D-leucine-3-(N-methyl-L-phenylalanine)- Tyr-leu-(N-Me)-phe-gln-pro-gln-arg-phe-NH2 Tyrosyl-leucyl-N-methylphenylalanyl-glutaminyl-prolyl-glutaminyl-arginyl-phenylalaninamide

pdb file: 709020.pdb
sdf file: 709020.sdf
directory: 709020

146163-06-6 L-Valinamide, L-seryl-L-isoleucyl-L-lysyl-L-valyl-L-alanyl- Ser-ile-lys-val-ala-val Seryl-isoleucyl-lysyl-valyl-alanyl-valinamide Sikvav

pdb file: 709064.pdb
sdf file: 709064.sdf
directory: 709064

146289-28-3 Cftr (505-511) L-Serine, N-(N-(N-(N-(N-L-asparaginyl-L-isoleucyl)-L-isoleucyl)-L-phenylalanyl)glycyl)-L-valyl-

pdb file: 709070.pdb
sdf file: 709070.sdf
directory: 709070

147256-26-6 HG12 Protein L-Lysine, L-methionyl-L-arginyl-L-alanyl-L-lysyl-L-tryptophyl-L-arginyl-L-lysyl-L-lysyl-L-arginyl-L-methionyl-L-arginyl-L-arginyl-L-leucyl-L-lysyl-L-arginyl-L-lysyl-L-arginyl-L-arginyl-L-lysyl-L-methionyl-L-arginyl-L-glutaminyl-L-arginyl-L-seryl- pHG12

pdb file: 709099.pdb
sdf file: 709099.sdf
directory: 709099

147862-03-1 3-(N-(2-(((Diphenylphosphono)methyl)amino)-3-(4-biphenylyl)propionyl)amino)propionic acid Cgs 25462 Cgs-25462 beta-Alanine, N-(3-(1,1'-biphenyl)-4-yl-N-((diphenoxyphosphinyl)methyl)-L-alanyl)-

pdb file: 709118.pdb
sdf file: 709118.sdf
directory: 709118

13-Lys-seminalplasmin 147958-06-3 Glycine, L-prolyl-L-lysyl-L-leucyl-L-leucyl-L-lysyl-L-threonyl-L-phenylalanyl-L-leucyl-L-seryl-L-lysyl-L-tryptophyl-L-isoleucyl- Seminalplasmin, lys(13)- Seminalplasmin, lysyl(13)- Spfk-res

pdb file: 709121.pdb
sdf file: 709121.sdf
directory: 709121

148067-21-4 Cn 412 Cn-412 L-Proline, L-isoleucyl-L-threonyl-L-seryl-L-phenylalanyl-L-alpha-glutamyl-L-alpha-glutamyl-L-alanyl-L-lysylglycyl-L-leucyl-L-alpha-aspartyl-L-arginyl-L-isoleucyl-L-asparaginyl-L-alpha-glutamyl-L-arginyl-L-methionyl-L-prolyl-L-prolyl-L-arginyl-L-arginyl-L-alpha-aspartyl-L-alanyl-L-methionyl-

pdb file: 709123.pdb
sdf file: 709123.sdf
directory: 709123

148182-34-7 Boc-flflf Boc-phe(D)-leu-phe(D)-leu-phe-OH L-Phenylalanine, N-(N-(N-(N-(N-((1,1-dimethylethoxy)carbonyl)-D-phenylalanyl)-L-leucyl)-D-phenylalanyl)-L-leucyl)- tert-Butyloxycarbonyl-phenylalanyl-leucyl-phenylalanyl-leucyl-phenylalanyl-OH

pdb file: 709129.pdb
sdf file: 709129.sdf
directory: 709129

148597-04-0 L-Glutamine, L-leucyl-L-tyrosyl-L-alpha-aspartyl-L-seryl-L-arginyl-L-seryl-L-isoleucyl-L-seryl-L-leucyl-L-alpha-glutamylglycyl-L-leucyl-L-leucyl-L-lysyl-L-valyl-L-leucyl-L-seryl-L-lysyl-L-alanyl-L-seryl-L-valylglycyl-L-prolyl-L-lysyl-L-alpha-glutamyl-L-threonyl-L-seryl-L-leucyl-L-prolyl L-Leucyl-L-tyrosyl-L-alpha-aspartyl-L-seryl-L-arginyl-L-seryl-L-isoleucyl-L-seryl-L-leucyl-L-alpha-glutamylglycyl-L-leucyl-L-leucyl-L-lysyl-L-valyl-L-leucyl-L-seryl-L-lysyl-L-alanyl-L-seryl-L-valylglycyl-L-prolyl-L-lysyl-L-alpha-glutamyl-L-threonyl-L-seryl-L-leucyl-L-prolyl-L-glutamine Nkb peptide 2 Nkb-P2 Peptide 2, neurokinin B Preprotachykinin B (50-79)

pdb file: 709150.pdb
sdf file: 709150.sdf
directory: 709150

148832-06-8 Ala-ser(P)-tyr(P)-ser-ala Alanyl-phosphoseryl-phosphotyrosyl-seryl-alanine Asptpsa

pdb file: 709158.pdb
sdf file: 709158.sdf
directory: 709158

78408-99-8 D-alpha-Glutamine, N2-(N-(N-(1-oxohexadecyl)muramoyl)-L-alanyl)- N-PA-Mur-ala-isogln N-Palmitoylmuramyl-alanyl-isoglutamine NP-Mdp

pdb file: 709159.pdb
sdf file: 709159.sdf
directory: 709159

149260-68-4 Adenoregulin L-Valine, glycyl-L-leucyl-L-tryptophyl-L-seryl-L-lysyl-L-isoleucyl-L-lysyl-L-alpha-glutamyl-L-valylglycyl-L-lysyl-L-alpha-glutamyl-L-alanyl-L-alanyl-L-lysyl-L-alanyl-L-alanyl-L-alanyl-L-lysyl-L-alanyl-L-alanylglycyl-L-lysyl-L-alanyl-L-alanyl-L-leucylglycyl-L-alanyl-L-valyl-L-seryl-L-alpha-L-glutamyl-L-alanyl-

pdb file: 709170.pdb
sdf file: 709170.sdf
directory: 709170

149309-76-2 L-Lysine, N2-(N2-(N-(N2-(N2-L-lysyl-L-arginyl)-L-arginyl)-3-(1-naphthalenyl)-L-alanyl)-L-lysyl)- Lys-arg-arg-(1-nap-ala)-lys-lys Lysyl-arginyl-arginyl-(1-naphthyl-alanyl)-lysyl-lysine SQ 32732 SQ-32732

pdb file: 709175.pdb
sdf file: 709175.sdf
directory: 709175

149348-15-2 Hes-1 factor Hes-1 gene product Hes-1 protein Hesx1 gene product Hesx1 protein L-Arginine, L-theonyl-L-glutaminyl-L-asparaginyl-L-glutaminyl-L-valyl-L-alpha-glutaminyl-L-valyl-L-leucyl-L-alpha-glutamyl-L-asparaginyl-L-valyl-L-phenylalanyl-L-arginyl-L-valyl-L-asparaginyl-L-cysteinyl-L-tyrosyl-L-prolylglycyl-L-isoleucyl-L-alpha-aspartyl-L-isoleucyl-L-arginyl-L-alpha-glutamyl-L-alpha-aspartyl-L-leucyl-L-alanyl-L-glutaminyl-L-lysyl-L-leucyl-L-asparaginyl-L-leucyl-L-alpha-glutamyl-L-alpha-glutamyl-L-alpha-aspartyl- Rat-hairy-like gene product Rat-hairy-like protein Rhl protein

pdb file: 709179.pdb
sdf file: 709179.sdf
directory: 709179

149471-11-4 Asp-arg-asn-phe-leu-arg-phe-NH2 Aspartyl-arginyl-asparaginyl-phenylalanyl-leucyl-arginyl-phenylalaninamide DF(2) Neuropeptide Drnflrfamide L-Phenylalaninamide, L-alpha-aspartyl-L-arginyl-L-asparaginyl-L-phenylalanyl-L-leucyl-L-arginyl- L-alpha-Aspartyl-L-arginyl-L-asparaginyl-L-phenylalanyl-L-leucyl-L-arginyl-L-phenylalaninamide Neuropeptide DF2

pdb file: 709187.pdb
sdf file: 709187.sdf
directory: 709187

(S-(R*,S*))-N-(N-(2-((2-Amino-3-mercaptopropyl)amino)-3-methylbutyl)-L-phenylalanyl)-L-methionine 149759-96-6 B 581 B-581 B581 L-Methionine, N-(N-(2-((2-amino-3-mercaptopropyl)amino)-3-methylbutyl)-L-phenylalanyl)-, (S-(R*,S*))-

pdb file: 709195.pdb
sdf file: 709195.sdf
directory: 709195

5-de-L-Tyrosine-6-de-L-proline-7-de-L-serinamidedermorphin 78700-74-0 Dermorphin (1-4) Dermorphin, 5-de-L-tyrosine-6-de-L-proline-7-de-L-serinamide- Tyr-ala-phe-gly Tyr-ala-phe-gly-OH Tyrosyl-alanyl-phenylalanyl-glycine

pdb file: 709206.pdb
sdf file: 709206.sdf
directory: 709206

78700-75-1 Glycinamide, L-tyrosyl-D-alanyl-L-phenylalanyl- Tapgnh2 Tyr-ala-phe-glynh2 Tyrosyl-alanyl-phenylalanyl-glycinamide

pdb file: 709208.pdb
sdf file: 709208.sdf
directory: 709208

150671-05-9 Ceratotoxin B L-Proline, L-seryl-L-isoleucylglycyl-L-seryl-L-alanyl-L-phenylalanyl-L-lysyl-L-lysyl-L-alanyl-L-leucyl-L-prolyl-L-valyl-L-alanyl-L-lysyl-L-lysyl-L-isoleucylglycyl-L-lysyl-L-alanyl-L-alanyl-L-leucyl-L-prolyl-L-isoleucyl-L-alanyl-L-lysyl-L-alanyl-L-alanyl-L-leucyl-

pdb file: 709228.pdb
sdf file: 709228.sdf
directory: 709228

151272-78-5 Ac-D-Nal-D-cpa-D-pal-ser-tyr-D-hci-leu-lys(ipr)-pro-D-ala-NH2 Antarelix D-Alaninamide, N-acetyl-3-(2-naphthalenyl)-D-alanyl-4-chloro-D-phenylalanyl-3-(3-pyridinyl)-D-alanyl-L-seryl-L-tyrosyl-N6-(aminocarbonyl)-D-lysyl-L-leucyl-N6-(1-methylethyl)-L-lysyl-L-prolyl- EP 24332

pdb file: 709237.pdb
sdf file: 709237.sdf
directory: 709237

154396-74-4 Casomokinin L Tyr-pro-phe-pro-pro-leu Tyrosyl-prolyl-phenylalanyl-prolyl-prolyl-leucine

pdb file: 709279.pdb
sdf file: 709279.sdf
directory: 709279

155178-13-5 Abeta 17-42 Amyloid beta-protein (17-42) L-Alanine, L-leucyl-L-valyl-L-phenylalanyl-L-phenylalanyl-L-alanyl-L-alpha-glutamyl-L-alpha-aspartyl-L-valylglycyl-L-seryl-L-asparaginyl-L-lysylglycyl-L-alanyl-L-isoleucyl-L-isoleucylglycyl-L-leucyl-L-methionyl-L-valylglycylglycyl-L-valyl-L-valyl-L-isoleucyl- L-Leucyl-L-valyl-L-phenylalanyl-L-phenylalanyl-L-alanyl-L-alpha-glutamyl-L-alpha-aspartyl-L-valylglycyl-L-seryl-L-asparaginyl-L-lysylglycyl-L-alanyl-L-isoleucyl-L-isoleucylglycyl-L-leucyl-L-methionyl-L-valylglycylglycyl-L-valyl-L-valyl-L-isoleucyl-L-alanine beta-Amyloid peptide 17-42

pdb file: 709292.pdb
sdf file: 709292.sdf
directory: 709292

156161-88-5 Asp-tyr-D-phe-gly-trp-(N-Me)nle-asp-phe-NH2 Aspartyl-tyrosyl-phenylalanyl-glycyl-tryptophyl-(N-methyl)norleucyl-aspartyl-phenylalaninamide L-Phenylalaninamide, L-alpha-aspartyl-L-tyrosyl-D-phenylalanylglycyl-1-methyl-L-tryptophyl-L-norleucyl-L-alpha-aspartyl- Snf 9007 Snf-9007

pdb file: 709310.pdb
sdf file: 709310.sdf
directory: 709310

156467-85-5 Gly-cys-cys-ser-asp-pro-arg-cys-ala-trp-arg-cys-NH2 Glycyl-cysteinyl-cysteinyl-seryl-asparginyl-prolyl-arginyl-cysteinyl-alanyl-tryptophyl-arginyl-cysteinamide L-Cysteinamide, glycyl-L-cysteinyl-L-cysteinyl-L-seryl-L-alpha-aspartyl-L-prolyl-L-arginyl-L-cysteinyl-L-alanyl-L-tryptophyl-L-arginyl-, cyclic (2-8),(3-12)-bis(disulfide) alpha-Conotoxin imi alpha-Ctx-imi

pdb file: 709317.pdb
sdf file: 709317.sdf
directory: 709317

156616-24-9 Aapfcmk L-Prolinamide, N-(3-carboxy-1-oxopropyl)-L-alanyl-L-alanyl-N-(3-chloro-2-oxo-1-(phenylmethyl)propyl)- N-(3-Carboxy-1-oxopropyl)-L-alanyl-L-alanyl-N-(3-chloro-2-oxo-1-(phenylmethyl)propyl)-L-prolinamide Succinyl-aapf-chloromethylketone Succinyl-aapf-cmk Succinyl-alanylalanyl-prolyl-phenylalanine chloromethylketone

pdb file: 709324.pdb
sdf file: 709324.sdf
directory: 709324

157184-61-7 Envelope 2 protein, HCV HCV e2 protein HCV envelope 2 protein Hepatitis C virus envelope 2 protein L-Methionyl-L-leucyl-L-leucyl-L-phenylalanyl-L-alanylglycyl-L-valyl-L-alpha-aspartylglycyl-L-tyrosyl-L-threonyl-L-threonyl-L-valyl-L-threonylglycylglycyl-L-alanyl-L-glutaminyl-L-alanyl-L-histidyl-L-threonyl-L-threonyl-L-glutaminyl-L-arginyl-L-phenylalanyl-L-alanyl-L-seryl-L-leucyl-L-phenylalanyl-L-threonyl-L-arginyl-L-glutaminyl-L-prolyl-L-glutaminyl-L-glutaminyl-L-arginyl-L-isoleucyl-L-glutaminyl-L-leucyl-L-valine L-Valine, L-methionyl-L-leucyl-L-leucyl-L-phenylalanyl-L-alanylglycyl-L-valyl-L-alpha-aspartylglycyl-L-tyrosyl-L-threonyl-L-threonyl-L-valyl-L-threonylglycylglycyl-L-alanyl-L-glutaminyl-L-alanyl-L-histidyl-L-threonyl-L-threonyl-L-glutaminyl-L-arginyl-L-phenylalanyl-L-alanyl-L-seryl-L-leucyl-L-phenylalanyl-L-threonyl-L-arginyl-L-glutaminyl-L-prolyl-L-glutaminyl-L-glutaminyl-L-arginyl-L-isoleucyl-L-glutaminyl-L-leucyl- e2 Protein, HCV

pdb file: 709336.pdb
sdf file: 709336.sdf
directory: 709336

157623-03-5 Glycinamide, L-asparaginyl-L-prolyl-L-phenylalanyl-L-histidyl-L-alanyl-L-tryptophyl- L-Asparaginyl-L-prolyl-L-phenylalanyl-L-histidyl-L-alanyl-L-tryptophylglycinamide Leucokinin 2

pdb file: 709340.pdb
sdf file: 709340.sdf
directory: 709340

(2R)-L-gamma-Glutamyl-3-((2-((bis(bis(2-chloroethyl)amino)phosphinyl)oxy)ethyl)sulfonyl)-L-alanyl-2-phenylglycine 158382-37-7 Glycine, L-gamma-glutamyl-3-((2-((bis(bis(2-chloroethyl)amino)phosphinyl)oxy)ethyl)sulfonyl)-L-alanyl-2-phenyl-, (2R)- N-(3-((2-((Bis(bis(2-chloroethyl)amino)phosphinyl)oxy)ethyl)sulfonyl)-N-glutamyl-alanyl)-2-phenyl-glycine Ter 286 Ter-286

pdb file: 709353.pdb
sdf file: 709353.sdf
directory: 709353

162435-91-8 D-Mephe-pro-arg-H Mephe-pro-arg N-Methylphenylalanyl-prolyl-arginine

pdb file: 709369.pdb
sdf file: 709369.sdf
directory: 709369

188106-30-1 L-Alaninamide, L-alanyl-L-valyl-L-seryl-L-alpha-glutamyl-L-histidyl-L-glutaminyl-L-leucyl-L-leucyl-L-histidyl-L-alpha-aspartyl-L-lysylglycyl-L-lysyl-L-seryl-L-isoleucyl-L-glutaminyl-L-alpha-aspartyl-L-leucyl-L-arginyl-L-arginyl-L-arginyl-L-alpha-glutamyl-L-leucyl-L-leucyl-L-alpha-glutamyl-L-lysyl-L-leucyl-L-leucyl-L-alpha-glutamyl-L-lysyl-L-leucyl-L-histidyl-L-threonyl-, acetate (salt), hydrate Semparatide acetate Semparatide acetate [USAN] Semparatide acetate hydrate

pdb file: 709415.pdb
sdf file: 709415.sdf
directory: 709415

78809-76-4 Bovine growth hormone fragment 87-124 L-Methionine, L-leucylglycyl-L-prolyl-L-leucyl-L-glutaminyl-L-phenylalanyl-L-leucyl-L-seryl-L-arginyl-L-valyl-L-phenylalanyl-L-threonyl-L-asparaginyl-L-seryl-L-leucyl-L-valyl-L-phenylalanylglycyl-L-threonyl-L-seryl-L-alpha-aspartyl-L-arginyl-L-valyl-L-tyrosyl-L-a lpha-glutamyl-L-lysyl-L-leucyl-L-lysyl-L-alpha-aspartyl-L-leucyl-L-alpha-glutamyl-L-alpha-glutamylglycyl-L-isoleucyl-L-leucyl-L-alanyl-L-leucyl- Somatotropin fragment 87-124

pdb file: 709418.pdb
sdf file: 709418.sdf
directory: 709418

2-Ala-5-val-enkephalin 78859-44-6 Anv-enkephalin Enkephalin, ala(2)-val(5)- Enkephalin, alanyl(2)-valine(5)- L-Valine, N-(N-(N-(N-L-tyrosyl-D-alanyl)glycyl)-L-phenylalanyl)- N-(N-(N-(N-L-Tyrosyl-D-alanyl)glycyl)-L-phenylalanyl)-L-valine

pdb file: 709427.pdb
sdf file: 709427.sdf
directory: 709427

2-Ala-5-valnh2-enkephalin 78873-50-4 Anv-enkephalinamide Enkephalin, ala(2)-valnh2(5)- Enkephalin, alanyl(2)-valinamide(5)- L-Tyrosyl-D-alanylglycyl-L-phenylalanyl-L-valinamide L-Valinamide, L-tyrosyl-D-alanylglycyl-L-phenylalanyl-

pdb file: 709431.pdb
sdf file: 709431.sdf
directory: 709431

79113-16-9 Interferon eicosapeptide Interferon eicosapeptide (human lymphoblastoid) Itf-ecp L-Glutamine, L-seryl-L-alpha-aspartyl-L-leucyl-L-prolyl-L-glutaminyl-L-threonyl-L-histidyl-L-seryl-L-leucylglycyl-L-asparaginyl-L-arginyl-L-arginyl-L-alanyl-L-leucyl-L-isoleucyl-L-leucyl-L-leucyl-L-alanyl-

pdb file: 709460.pdb
sdf file: 709460.sdf
directory: 709460

79338-56-0 D-Phe-pro-arg-H L-Arginine, N2-(1-D-phenylalanyl-L-prolyl)- Phe-pro-arg Phenylalanyl-prolyl-arginine

pdb file: 709482.pdb
sdf file: 709482.sdf
directory: 709482

79358-73-9 L-Argininamide, D-prolyl-L-phenylalanyl-N-heptyl- Pro-phe-N-heptyl-arg-NH2 Prolyl-phenylalanyl-N-heptylargininamide S 2441 S-2441

pdb file: 709487.pdb
sdf file: 709487.sdf
directory: 709487

79486-60-5 D-Phenylalanyl-L-cysteinyl-L-phenylalanyl-D-tryptophyl-L-lysyl-L-threonyl-L-cysteinamide cyclic (2-7)-disulfide H-Cys(2)-phe(3)-trp(4)-lys(5)-thr(6)-cys(7)-NH2-cyclic (2-7) disulfide L-Cysteinamide, D-phenylalanyl-L-cysteinyl-L-phenylalanyl-D-tryptophyl-L-lysyl-L-threonyl-, cyclic (2-7)-disulfide San 201-456 Sandoz-201-456

pdb file: 709504.pdb
sdf file: 709504.sdf
directory: 709504

79525-56-7 Cyclic leucine enkephalin Cyclic(glycylglycyl-L-phenylalanyl-L-leucyl-L-lysyl-L-lysyl-L-tyrosyl) Lys-lys-linked cyclic leucine enkephalin

pdb file: 709510.pdb
sdf file: 709510.sdf
directory: 709510

79561-42-5 Glycinamide, L-tyrosyl-D-alanylglycyl-4-fluoro-L-phenylalanyl-L-2-phenyl-, monoacetate (salt) L-Tyrosyl-D-alanylglycyl-4-fluoro-L-phenylalanyl-L-2-phenylglycinamide monoacetate (salt) LY 123502 LY-123502 Tyr-ala-gly-4-F-phe-phenyl-glycinamide acetate Tyrosine-alanine-glycine-4-F-phenylalanine-phenyl-glycinamide acetate

pdb file: 709519.pdb
sdf file: 709519.sdf
directory: 709519

79787-27-2 D-Glutamine, N2-(N-(N-acetylmuramoyl)-L-alanyl)-, methyl ester Murametide N-Acetylmuramyl-alanylglutamine methyl ester

pdb file: 709561.pdb
sdf file: 709561.sdf
directory: 709561

2-(2-Acetamido-2-deoxyglucose-3-O-yl)hexanoyl-alanyl-isoglutamine 79795-28-1 Acmu-ala-isogln propyl ester D-Glutamine, N2-(N-(N-acetylmuramoyl)-L-alanyl)-, propyl ester Mdp-3' n-propyl ester N-Acetylmuramyl-alanyl-isoglutamine 3'-n-propyl ester

pdb file: 709563.pdb
sdf file: 709563.sdf
directory: 709563

79924-62-2 L-Lysine, N2-(N-(N-(N-(N-(N-(N-glycylglycyl)-L-phenylalanyl)-L-methionyl)-L-threonyl)-L-seryl)-L-alpha-glutamyl)- beta-Endorphin (2-9) beta-Endorphin 2-9

pdb file: 709586.pdb
sdf file: 709586.sdf
directory: 709586

6-(N-Glutarylphenylalanylamido)quinoline 6-Gpaaq 80115-54-4 Pentanoic acid, 5-oxo-5-((2-oxo-1-(phenylmethyl)-2-(6-quinolinylamino)ethyl)amino)-, (S)-

pdb file: 709647.pdb
sdf file: 709647.sdf
directory: 709647

80180-63-8 L-Phenylalanine, N-(N-(N-(N-formyl-L-methionyl)-L-leucyl)-L-phenylalanyl)- N-(N-(N-(N-Formyl-L-methionyl)-L-leucyl)-L-phenylalanyl)-L-phenylalanine N-Formyl-methionyl-leucyl-phenylalanyl-phenylalanine f-Met-leu-phe-phe fMLPP

pdb file: 709669.pdb
sdf file: 709669.sdf
directory: 709669

80317-95-9 GRPP Glicentin 1-30 Glicentin-related pancreatic peptide L-Aspartic acid, L-arginyl-L-seryl-L-leucyl-L-glutaminyl-L-asparaginyl-L-threonyl-L-alpha-glutamyl-L-alpha-glutamyl-L-lysyl-L-seryl-L-arginyl-L-seryl-L-phenylalanyl-L-prolyl-L-alanyl-L-prolyl-L-glutaminyl-L-threonyl-L-alpha-aspartyl-L-prolyl-L-leucyl-L-alpha-asparty l-L-alpha-aspartyl-L-prolyl-L-alpha-aspartyl-L-glutaminyl-L-methionyl-L-threonyl-L-alpha-glutamyl-

pdb file: 709709.pdb
sdf file: 709709.sdf
directory: 709709

80317-97-1 Benzoic acid, 4-((3-(dimethylamino)-1-oxopropyl)amino)-, ethyl ester, monohydrochloride JK-43 N,N-Dimethyl-D,L-alanylbenzocaine hydrochloride N,N-Dimethylalanylbenzocaine

pdb file: 709710.pdb
sdf file: 709710.sdf
directory: 709710

4-Tapap 80456-99-1 N(alpha)-(4-Toluenesulfonyl)-4-amidinophenylalanylpiperidine Piperidine, 1-(3-(4-(aminoiminomethyl)phenyl)-2-(((4-methylphenyl)sulfonyl)amino)-1-oxopropyl)-, (+-)-

pdb file: 709742.pdb
sdf file: 709742.sdf
directory: 709742

80632-52-6 Enkephalin-leu, sulfonated L-Leucine, N-(N-(N-(N-(O-sulfo-L-tyrosyl)glycyl)glycyl)-L-phenylalanyl)- O-Sulfated leu-enkephalin Sulfonated leu-enkephalin Sulfonated leucine enkephalin

pdb file: 709777.pdb
sdf file: 709777.sdf
directory: 709777

80733-88-6 DGPNP Dansyl-gly-nitro-phe-pro Dansyl-glycyl-nitrophenylalanyl-proline Dansylglycyl-nitrophenylalanyl-proline Dns-gly-phe(No2)-pro L-Proline, 1-(N-(N-((5-(dimethylamino)-1-naphthalenyl)sulfonyl)glycyl)-4-nitro-L-phenylalanyl)-

pdb file: 709795.pdb
sdf file: 709795.sdf
directory: 709795

80976-69-8 BPHP Benzylpenicilloyl-heptapeptide Benzylpenicilloyl-leu-pro-ala-ser-asn-gly-val L-Valine, N-(N-(N2-(O-((5,5-dimethyl-2-(((phenylacetyl)amino)methyl)-4-thiazolidinyl)carbonyl)-N-(N-(1-L-leucyl-L-prolyl)-L-alanyl)-L-seryl)-L-asparaginyl)glycyl)-, (2R-trans)-

pdb file: 709842.pdb
sdf file: 709842.sdf
directory: 709842

4-Pro-7,9-trp-substance P (4-11) 4-Prolyl-7,9-trytophan-substance P (4-11) 81039-85-2 L-Methioninamide, D-prolyl-L-glutaminyl-L-glutaminyl-D-tryptophyl-L-phenylalanyl-D-tryptophyl-L-leucyl- Ptt-SP(4-11) Substance P (4-11), pro(4)-trp(7,9)- Substance P (4-11), prolyl(4)-tryptophan(7,9)-

pdb file: 709856.pdb
sdf file: 709856.sdf
directory: 709856

(N-C)Phe-leu 81109-91-3 D-Leucine, N-(N-(carboxymethyl)-D-phenylalanyl)- N-(N-(Carboxymethyl)-D-phenylalanyl)-D-leucine N-Carboxymethyl-phe-leu N-Carboxymethyl-phenylalanylleucine

pdb file: 709869.pdb
sdf file: 709869.sdf
directory: 709869

81156-93-6 Arg-arg-leu-ile-glu-asp-ala-glu-tyr-ala-ala-arg-gly Arginyl-arginyl-leucyl-isoleucyl-glutamyl-aspartyl-alanyl-glutamyl-tyrosyl-alanyl-alanyl-arginyl-glycine Glycine, L-arginyl-L-arginyl-L-leucyl-L-isoleucyl-L-alpha-glutamyl-L-alpha-aspartyl-L-alanyl-L-alpha-glutamyl-L-tyrosyl-L-alanyl-L-alanyl-L-arginyl- RR-Src

pdb file: 709883.pdb
sdf file: 709883.sdf
directory: 709883

81286-16-0 L-Glutamic acid, N-(N2-(1-(N-(N-(N-(1-(N2-(N-(N2-(N-L-seryl-L-alanyl)-L-asparaginyl)-L-seryl)-L-asparaginyl)-L-prolyl)-L-alanyl)-L-methionyl)-L-alanyl)-L-prolyl)-L-arginyl)- SS28(1-12) Somatostatin 28(1-12) Somatostatin 28-(1-12)

pdb file: 709910.pdb
sdf file: 709910.sdf
directory: 709910

4-Azidophenylalanyl-alanyl-glycyl-glycine 81381-56-8 APAGG Glycine, N-(N-(N-(4-azido-L-phenylalanyl)-L-alanyl)glycyl)- Phe(N3)-L-ala-gly-gly

pdb file: 709927.pdb
sdf file: 709927.sdf
directory: 709927

81391-38-0 L-Alanine, N-(1-L-phenylalanyl-L-prolyl)- N-(1-L-Phenylalanyl-L-prolyl)-L-alanine Phe-pro-ala Phenylalanyl-prolyl-alanine

pdb file: 709929.pdb
sdf file: 709929.sdf
directory: 709929

81484-15-3 Benzoyl-leu-ala-arg-alpha-naphthylester Benzoyl-leucyl-alanyl-arginine-alpha-naphthylester Benzoylleucyl-alanyl-arginine-alpha-naphthylester Bz-Leu-ala-arg-NE L-Arginine, N2-(N-(N-benzoyl-L-leucyl)-L-alanyl)-, 1-naphthalenyl ester

pdb file: 709951.pdb
sdf file: 709951.sdf
directory: 709951

81485-13-4 Heptanamide, 6-methyl-N-(1-methyl-2-((3-methylbutyl)amino)-2-oxoethyl)-4-((3-methyl-2-((3-methyl-1-oxobutyl)amino)-1-oxobutyl)amino)-3-oxo-, (4S-(N(R*),4R*(R*)))- Isovaleryl-valyl-3-oxo-4-amino-6-methylheptanoyl-alanyl-isoamylamide Pepstatin ketone analog

pdb file: 709954.pdb
sdf file: 709954.sdf
directory: 709954

81541-05-1 Cecropin A (1-33) L-Threonine, L-lysyl-L-tryptophyl-L-lysyl-L-leucyl-L-phenylalanyl-L-lysyl-L-lysyl-L-isoleucyl-L-alpha-glutamyl-L-lysyl-L-valylglycyl-L-glutaminyl-L-asparaginyl-L-isoleucyl-L-arginyl-L-alpha-aspartylglycyl-L-isoleucyl-L-isoleucyl-L-lysyl-L-alanylglycyl

pdb file: 709969.pdb
sdf file: 709969.sdf
directory: 709969

6-O-(3-Hydroxy-2-docosylhexacosanoyl)-N-acetylmuramyl-L-alanyl-D-isoglutamine 6-O-(3-Hydroxy-2-docosylhexacosanoyl)muramyl dipeptide 81649-55-0 BH48-Mdp D-alpha-Glutamine, N2-(N-(N-(2-docosyl-3-hydroxy-1-oxohexacosyl)muramyl)-L-alanyl)-

pdb file: 709998.pdb
sdf file: 709998.sdf
directory: 709998

81655-72-3 D-alpha-Glutamine, N2-(N-muramoyl-L-alanyl)-, monohydrochloride Muramoyl-L-alanyl-D-isoglutamine Muramoyl-ala-iso-gln Muramoyl-alanylisoglutamine

pdb file: 710002.pdb
sdf file: 710002.sdf
directory: 710002

81733-82-6 L-Phenylalaninamide, L-tyrosyl-D-alanylglycyl-4-nitro- L-Tyrosyl-D-alanylglycyl-4-nitro-L-phenylalaninamide Tag-NP Tyr-ala-gly-phe(No2)-NH2 Tyrosyl-alanyl-glycyl-nitrophenylalanylamide

pdb file: 710012.pdb
sdf file: 710012.sdf
directory: 710012

82008-60-4 D-Arginine, N2-(N-(N-(N-(N-L-tyrosylglycyl)glycyl)-L-phenylalanyl)-L-leucyl)- Dynorphin (1-6) Tyr-gly-gly-phe-leu-arg Tyrosyl-glycyl-glycyl-phenylalanyl-leucyl-arginine

pdb file: 710067.pdb
sdf file: 710067.sdf
directory: 710067

82017-64-9 Guanyl-damme L-Phenylalaninamide, N-(aminoiminomethyl)-L-tyrosyl-D-alanylglycyl-N-(1-(hydroxymethyl)-3-(methylsulfinyl)propyl)-nalpha-methyl-, (1S)-

pdb file: 710069.pdb
sdf file: 710069.sdf
directory: 710069

82050-16-6 BPLL Boc-phe-leu-lys-H Butyloxycarbonyl-phenylalanyl-leucyl-lysine L-Phenylalaninamide, N2-((1,1-dimethylethoxy)carbonyl)-L-glutaminyl-N-(5-amino-1-formylpentyl)-, (S)-

pdb file: 710074.pdb
sdf file: 710074.sdf
directory: 710074

82080-92-0 Glycine, N-(N-(methoxycarbonyl)-L-phenylalanyl)-, 4-nitrophenyl ester Meo-phe-gly-nph N-Methoxycarbony-L-phenylalanylglycine para-nitrophenyl ester N-Methoxycarbonyl-phe-gly-4-nitrophenyl ester N-Methoxycarbonylphenylalanylglycine 4-nitrophenyl ester

pdb file: 710082.pdb
sdf file: 710082.sdf
directory: 710082

(S)-N-((1,1-Dimethylethoxy)carbonyl)-D-phenylalanyl-N-(5-amino-1-formylpentyl)-L-phenylalaninamide 82084-92-2 Boc-dppl Boc-phe-phe-lys-al L-Phenylalaninamide, N-((1,1-dimethylethoxy)carbonyl)-D-phenylalanyl-N-(5-amino-1-formylpentyl)-, (S)- t-Butoxycarbonyl-phenylalanyl-phenylalanyl-lysinal

pdb file: 710083.pdb
sdf file: 710083.sdf
directory: 710083

82131-82-6 H 77 H-77 L-Tyrosine, N-(N-(N-(2-((N-(N-(1-D-histidyl-L-prolyl)-L-phenylalanyl)-L-histidyl)amino)-4-methylpentyl)-L-leucyl)-L-valyl)-, (S)-

pdb file: 710094.pdb
sdf file: 710094.sdf
directory: 710094

82155-66-6 L-Valinamide, N-(3-carboxy-1-oxopropyl)-L-alanyl-L-tyrosyl-L-leucyl-N-(4-nitrophenyl)- Suc-ala-tyr-leu-val-pna Succinyl-alanyl-tyrosyl-leucyl-valyl-4-nitroanilide Succinyl-alanyl-tyrosyl-leucyl-valyl-para-nitroanilide

pdb file: 710104.pdb
sdf file: 710104.sdf
directory: 710104

2-Ala-aminoethyl dimer-leu-enkephalinamide 82221-89-4 DPE2 Enkephalinamide-leu, ala(2)-aminoethyl dimer- Enkephalinamide-leu, alanine(2)-aminoethyl dimer- L-Leucinamide, L-tyrosyl-D-alanylglycyl-L-phenylalanyl-N-(2-((N-(N-(N-(N-L-tyrosyl-D-alanyl)glycyl)-L-phenylalanyl)-L-leucyl)amino)ethyl)- Leu-enkephalinamide, ala(2) aminoethyl dimer- Leucine-enkephalinamide, ala(2)-aminoethyl dimer-

pdb file: 710124.pdb
sdf file: 710124.sdf
directory: 710124

82252-46-8 Ang (6-13) Angiotensinogen (6-13) His-pro-phe-his-leu-val-ile-his L-Histidine, N-(N-(N-(2-((N-(N-(1-L-histidyl-L-prolyl)-L-phenylalanyl)-L-histidyl)amino)-4-methylpentyl)-L-valyl)-L-isoleucyl)-, (S)-

pdb file: 710131.pdb
sdf file: 710131.sdf
directory: 710131

(Des-tyr-D-phe(3))beta-casomorphin 82289-41-6 Bch 325 Des-(tyr(1))CM-5 Glycine, N-(1-(N-L-prolyl-L-phenylalanyl)-L-prolyl)- Pro-phe-pro-gly Prolyl-phenylalanyl-prolyl-glycine beta-Casomorphin, des-tyr- beta-Casomorphin, des-tyr-D-phe(3)- beta-Casomorphin-des-tyr-(D-pro(4))- beta-Casomorphin-des-tyr-(L-pro(4))- beta-Cdt

pdb file: 710136.pdb
sdf file: 710136.sdf
directory: 710136

2-(5-Amino-val)-3-de-gly-met-enkephalin 82518-82-9 Enkephalin-met, 5-amino-val(2)-des-gly(3)- Enkephalin-met, 5-aminovalyl(2)-desglycine(3)- H-Tyr-ava-phe-met-OH L-Methionine, N-(N-(5-((2-amino-3-(4-hydroxyphenyl)-1-oxopropyl)amino)-1-oxopentyl)-L-phenylalanyl)-, (S)- Met-enkephalin, 5-amino-val(2)-des-gly(3)- Methionine-enkephalin, 5-amino-val(2)-des-gly(3)- Tyrosyl-5-aminovalerylphenylalanylmethionine

pdb file: 710183.pdb
sdf file: 710183.sdf
directory: 710183

5-Dimethylaminonaphthalene-1-sulfonyl-phe-leu-arg 82543-28-0 Dansyl-phenylalanyl-leucyl-arginine Dns-phe-leu-arg L-Arginine, N2-(N-(N-((5-(dimethylamino)-1-naphthalenyl)sulfonyl)-L-phenylalanyl)-L-leucyl)-

pdb file: 710188.pdb
sdf file: 710188.sdf
directory: 710188

82727-36-4 Alaninamide, 1-((1,1-dimethylethoxy)carbonyl)-trans-4-hydroxy-L-prolyl-2-methylalanyl-N-(1-(hydroxymethyl)-2-phenylethyl)-2-methyl-, (S)- BHAAP Boc-hyp-aib-aib-phol t-Butyloxycarbonyl-hydroxypro-aib-aib-phe-ol tert-Butyloxycarbonyl-hydroxyprolyl-alpha-aminoisobutyryl-alpha-aminoisobutyryl-phenylalaninol

pdb file: 710329.pdb
sdf file: 710329.sdf
directory: 710329

82801-73-8 Arg-7-glu Arg-lys-arg-ala-arg-lys-glu Arginyl-lysyl-arginyl-alanyl-arginyl-lysyl-glutamic acid L-Glutamic acid, N-(N2-(N2-(N-(N2-(N2-L-arginyl-L-lysyl)-L-arginyl)-L-alanyl)-L-arginyl)-L-lysyl)-

pdb file: 710347.pdb
sdf file: 710347.sdf
directory: 710347

5(2)-Hydroxy-6(R)-cysteinylglycinyl-7-9-trans-11,14-cis-eicosatetraenoic acid-S,S-dioxide 82850-10-0 Glycine, N-(3-((1-(4-carboxy-1-hydroxybutyl)-2,4,6,9-pentadecatetraenyl)sulfonyl)-L-alanyl)-, (R-(R*,S*-(E,E,Z,Z)))- Leukotriene D-4 sulfone

pdb file: 710359.pdb
sdf file: 710359.sdf
directory: 710359

82867-31-0 A-A-A-L-NO2-P-A-A-A Ac-Ala-ala-lys-No(2)-phe-ala-ala-amide Acetylalanyl-alanyl-lysyl nitrite-phenylalanyl-alanyl-alaninamide L-Alaninamide, N-acetyl-L-alanyl-L-alanyl-L-lysyl-4-nitro-L-phenylalanyl-L-alanyl-

pdb file: 710363.pdb
sdf file: 710363.sdf
directory: 710363

83296-42-8 Amidated joining peptide Glutamamide, L-alpha-glutamyl-L-alpha-aspartyl-L-valyl-L-seryl-L-alanylglycyl-L-alpha-glutamyl-L-alpha-aspartyl-L-cysteinylglycyl-L-prolyl-L-leucyl-L-prolyl-L-alpha-glutamylglycylglycyl-L-prolyl-L-alpha-glutamyl-L-prolyl-L-arginyl-L-seryl-L-alpha-aspartylglycyl-L-alanyl-L-lysyl-L-prolylglycyl-L-prolyl-L-arginyl- JP-N Peptide Pro-opiomelanocortin amidated joining peptide Pro-opiomelanocortin joining peptide(79-108)

pdb file: 710442.pdb
sdf file: 710442.sdf
directory: 710442

2-Mercaptoacetyl-L-phenylalanyl-L-leucine 2-Mercaptoacetyl-phenylalanylleucine 83328-02-3 Hsac-phe-leu L-Leucine, N-(N-(mercaptoacetyl)-L-phenylalanyl)-

pdb file: 710447.pdb
sdf file: 710447.sdf
directory: 710447

1-(N-(1-Ethoxycarbonyl)-3-phenyl-1S-propyl)alanyl-2,3-dihydro-2S-indole-2-carboxylate sodium 1H-Indole-2-carboxylic acid, 1-(2-((1-(ethoxycarbonyl)-3-phenylpropyl)amino)-1-oxopropyl)-2,3-dihydro-, monosodium salt, (2S-(1(R*(R*)),2R*))- 83348-78-1 Cgs 13928C Cgs-13928-C Wy 44,655

pdb file: 710452.pdb
sdf file: 710452.sdf
directory: 710452

83375-11-5 D-alpha-Glutamine, N2-(N-(N-acetyl-1-thio-beta-muramoyl)-L-alanyl)- N-Acetyl-thiomuramyl-alanyl-isoglutamine Thiomuramyl dipeptide

pdb file: 710460.pdb
sdf file: 710460.sdf
directory: 710460

83380-08-9 Enkephalinamide, met-metazocine- L-Methioninamide, N-((3,4,5,6-tetrahydro-8-hydroxy-3,6,11-trimethyl-2,6-methano-3-benzazocin-2(1H)-yl)carbonyl)glycylglycyl-L-phenylalanyl-, (2R-(2alpha,6beta,11R*))- Met-enkephalinamide-metazocine Methionine enkephalinamide-metazocine

pdb file: 710463.pdb
sdf file: 710463.sdf
directory: 710463

2-Ala-N-(2-((4-azido-2-nitrophenyl)amino)N-ethyl(5))-leu-enkephalinamide 83544-71-2 ENAPE Enkephalinamide-leu, ala(2)-N-(2-((4-azido-2-nitrophenyl)amino)N-ethyl(5))- Enkephalinamide-leu, alanine(2)-N-(2-((4-azido-2-nitrophenyl)amino)N-ethyl(5))- L-Leucinamide, L-tyrosyl-D-alanylglycyl-L-phenylalanyl-N-(2-((4-azido-2-nitrophenyl)amino)ethyl)-, (2S-(1(R*(R*)),2R*))- Leu-enkephalinamide, ala(2)-N-(2-((4-azido-2-nitrophenyl)amino)N-ethyl(5))- Leucine-enkephalinamide, ala(2)-N-(2-((4-azido-2-nitrophenyl)amino)N-ethyl(5))-

pdb file: 710545.pdb
sdf file: 710545.sdf
directory: 710545

83575-50-2 Benzyloxycarbonylglycyl-phenylalanyl-citrulline 4-nitroanilide L-Ornithinamide, N-((phenylmethoxy)carbonyl)glycyl-L-phenylalanyl-N5-(aminocarbonyl)-N-(4-nitrophenyl)- N-Benzyloxycarbonyl-L-glycyl-phenylalanyl-citrulline para-nitroanilide Z-Gly-phe-cit 4-npha

pdb file: 710549.pdb
sdf file: 710549.sdf
directory: 710549

2-(N'-Acetylphenylalanylamino)ethyl-2'-pyridyl disulfide 2-Apaeps 83578-20-5 Benzenepropanamide, alpha-(acetylamino)-N-(2-(2-pyridinyldithio)ethyl)-, (S)-

pdb file: 710550.pdb
sdf file: 710550.sdf
directory: 710550

83590-79-8 EINECS 280-505-2 L-Ornithinamide, N-((phenylmethoxy)carbonyl)-L-phenylalanyl-N5-(aminocarbonyl)-N-(4-nitrophenyl)- N-((Benzyloxy)carbonyl)-3-phenyl-L-alanyl-N5-carbamoyl-N-(p-nitrophenyl)-L-ornithinamide N-Benzyloxycarbonylphenylalanyl-citrulline 4-nitroanilide

pdb file: 710553.pdb
sdf file: 710553.sdf
directory: 710553

83808-39-3 Glt(ala)(3)nhpr Glutaryl-ala-ala-ala-propylamide Glutaryl-alanyl-alanyl-alanyl-propylamide Glutaryl-trialanyl-propylamide L-Alaninamide, N-(4-carboxy-1-oxobutyl)-L-alanyl-L-alanyl-N-propyl-

pdb file: 710595.pdb
sdf file: 710595.sdf
directory: 710595

83808-35-9 Glt(ala)(3)nhet Glt-ala-ala-ala-ethylamide Glutaryl-alanyl-alanyl-alanyl-ethylamide Glutaryl-trialanine ethylamide Glutaryl-trialanyl-ethylamide L-Alaninamide, N-(4-carboxy-1-oxobutyl)-L-alanyl-L-alanyl-N-ethyl-

pdb file: 710596.pdb
sdf file: 710596.sdf
directory: 710596

83808-37-1 Glutaryl-ala-ala-pro-NH-ET Glutaryl-alanyl-alanyl-prolylethylamide L-Prolinamide, N-(4-carboxy-1-oxobutyl)-L-alanyl-L-alanyl-N-ethyl-

pdb file: 710597.pdb
sdf file: 710597.sdf
directory: 710597

83903-26-8 Fnlrf amide L-Phenylalaninamide, L-phenylalanyl-L-norleucyl-L-arginyl-, (2S-(1(R*(R*)),2alpha,3abeta,7abeta))- Phe-nle-arg-phe-NH2 Phenylalanyl-norleucyl-arginyl-phenylalaninamide

pdb file: 710608.pdb
sdf file: 710608.sdf
directory: 710608

(Tyr-ala-gly-phe-NH2)2 (Tyrosyl-alanyl-glycyl-phenylalaninamide)dimer 83916-01-2 Biphalin Bis(tyr-ala-gly-phenh2)hydrazide Bis(tyrosyl-alanyl-glycyl-phenylalaninamide)hydrazide D-ENK D-Enk-O Dala(2) L-Phenylalanine, N-(N-(N-L-tyrosyl-D-alanyl)glycyl)-, 2-(N-(N-(N-L-tyrosyl-D-alanyl)glycyl)-L-phenylalanyl)hydrazide

pdb file: 710614.pdb
sdf file: 710614.sdf
directory: 710614

83916-02-3 D-Enk-3 L-Phenylalaninamide, L-tyrosyl-D-alanylglycyl-N-(3-((N-(N-(N-L-tyrosyl-D-alanyl)glycyl)-L-phenylalanyl)amino)propyl)- Tyr-ala-gly-phe-NH-(CH2)3-HN-phe-gly-ala-tyr Tyrosyl-alanyl glycyl-phenylalaninamide-propyl-phenylalaninamide-glycyl-alanyl-tyrosine

pdb file: 710615.pdb
sdf file: 710615.sdf
directory: 710615

83961-79-9 Fmet-ala-leu Formylmethionyl-alanyl-leucine L-Leucine, N-(N-(N-formyl-L-methionyl)-L-alanyl)-

pdb file: 710622.pdb
sdf file: 710622.sdf
directory: 710622

1-Des-tyr-2-ala-leu-enkephalinamide 84145-88-0 DTALE Des-tal-enkephalinamide Enkephalinamide-leu, de-tyr(1)-ala(2)- Enkephalinamide-leu, des-tyrosyl(1)-alanine(2)- L-Leucinamide, D-alanylglycyl-L-phenylalanyl- Leu-enkephalinamide, de-tyr(1)-ala(2)- Leucine-enkephalinamide, de-tyr(1)-ala(2)-

pdb file: 710949.pdb
sdf file: 710949.sdf
directory: 710949

84268-42-8 Asn-ala-gly-ala Asparaginyl-alanyl-glycyl-alanine L-Alanine, N-(N-(N-L-asparaginyl-L-alanyl)glycyl)-

pdb file: 710973.pdb
sdf file: 710973.sdf
directory: 710973

84311-50-2 L-Lysine, N6-(6-((4-azido-2-nitrophenyl)amino)-1-oxohexyl)-N2-(N-(N-(N-(N-(N-formyl-L-norleucyl)-L-leucyl)-L-phenylalanyl)-L-norleucyl)-L-tyrosyl)- N-Formyl-nle-leu-phe-nle-125-I-tyr-lys-N-epsilon-6-(4'azido-2'-nitrophenylamino)hexanoate N-Formyl-nle-leu-phe-nle-tyr-N-epsilon-(6-(4'azido-2'-nitrophenylamino)hexanoyl)lys N-Formyl-norleucyl-leucyl-phenylalanyl-norleucyl-tyrosyl-N-epsilon-(6-(4'-azido-2'-nitrophenylamino)hexanoyl)lysine Nph-peptide

pdb file: 710978.pdb
sdf file: 710978.sdf
directory: 710978

84573-39-7 Hgh (4-15) Human growth hormone (4-15) L-Leucine, N-(N-(N-(N2-(N-(N-(N-(N2-(N-(N-(1-L-isoleucyl-L-prolyl)-L-leucyl)-L-seryl)-L-arginyl)-L-leucyl)-L-phenylalanyl)-L-alpha-aspartyl)-L-asparaginyl)-L-alanyl)-L-methionyl)- Somatotropin (4-15)

pdb file: 711033.pdb
sdf file: 711033.sdf
directory: 711033

6-(N-Carbobenzoxy-alanyl-alanyl-alanylamido)quinoline 6-(N-Cbz-ala-ala-ala-amido)quinoline 84614-60-8 CAAAQ

pdb file: 711056.pdb
sdf file: 711056.sdf
directory: 711056

84619-63-6 Asn-ala-gly-ala-NH2 Asparaginyl-D-alanyl-glycyl-alaninamide Asparaginyl-alanyl-glycyl-alaninamide L-Alaninamide, L-asparaginyl-D-alanylglycyl-

pdb file: 711059.pdb
sdf file: 711059.sdf
directory: 711059

84619-64-7 Asn-ala-gly-ala-asn Asparaginyl-alanyl-glycyl-alanyl-asparagine L-Asparagine, N2-(N-(N-(N-L-asparaginyl-L-alanyl)glycyl)-L-alanyl)-

pdb file: 711060.pdb
sdf file: 711060.sdf
directory: 711060

84676-48-2 ALAL Ala-leu-ala-leu Alanyl-leucyl-alanyl-leucine L-Leucine, N-(N-(N-L-alanyl-L-leucyl)-L-alanyl)-

pdb file: 711067.pdb
sdf file: 711067.sdf
directory: 711067

84768-09-2 Brl 36378 Brl-36378 L-Proline, 1-(N-(4-(2,3-dihydro-2-benzofuranyl)-1-(ethoxycarbonyl)butyl)-L-alanyl)- N-(N-((4-(2,3-Dihydro-2-benzofuranyl)-1-(ethoxycarbonyl))butyl)-(s)-alanyl)-(s)-proline

pdb file: 711090.pdb
sdf file: 711090.sdf
directory: 711090

84902-97-6 Boc-aib-pro-pro-nhme L-Prolinamide, N-((1,1-dimethylethoxy)carbonyl)-2-methylalanyl-L-prolyl-N-methyl- tert-Butyloxycarbonyl-2-aminoisobutyryl-prolyl-prolyl-methylamide

pdb file: 711114.pdb
sdf file: 711114.sdf
directory: 711114

84979-67-9 L-Arginine, L-arginyl-L-lysyl-L-alpha-aspartyl-L-valyl-L-tyrosyl-L-valyl-L-alpha-glutamyl-L-leucyl-L-tyrosyl-L-leucyl-L-glutaminyl-L-seryl-L-leucyl-L-threonyl-L-alanyl-L-leucyl-L-lysyl- TP 32-49 Thymopoietin II octadecapeptide (32-49)

pdb file: 711123.pdb
sdf file: 711123.sdf
directory: 711123

5-Arg-7,9-trp-substance P (5-11) 5-Arginyl-7,9-tryptophan-substance P (5-11) 85077-79-8 L-Methioninamide, L-arginyl-L-glutaminyl-D-tryptophyl-L-phenylalanyl-D-tryptophyl-L-leucyl- SP(5-11)-Att Substance P (5-11), arg(5)-trp(7,9)- Substance P (5-11), arginyl(5)-tryptophan(7,9)-

pdb file: 711136.pdb
sdf file: 711136.sdf
directory: 711136

85139-12-4 H 142 H-142 L-Lysine, N2-(N-(N-(N-(4-methyl-2-((N-(N-(1-(N-L-prolyl-L-histidyl)-L-prolyl)-L-phenylalanyl)-L-histidyl)amino)pentyl)-L-valyl)-L-isoleucyl)-L-histidyl)-, (S)-

pdb file: 711149.pdb
sdf file: 711149.sdf
directory: 711149

24587-41-5 BRN 5145119 L-Tryptophan, N-L-phenylalanyl- Phenylalanyltryptophan Tryptophan, N-(3-phenyl-L-alanyl)-, L- Tryptophan-L-phenylalanine, L-

pdb file: 711158.pdb
sdf file: 711158.sdf
directory: 711158

85416-56-4 D-Alanine, N-(1-(N2-(N-(N2-(N-(N-(N-(N-(N-acetyl-4-chloro-D-phenylalanyl)-4-chloro-D-phenylalanyl)-L-phenylalanyl)-L-seryl)-L-tyrosyl)-D-arginyl)-L-leucyl)-L-arginyl)-L-prolyl)- GNRH, N-Ac-(4-Cl-phe)(1,2)-phe(3)-arg(6)-alanh2(10)- LHRH, N-Acetyl-4-chlorophenylalanyl(1,2)-phenylalanyl(3)-arginyl(6)-alanimide(10)- LHRH, N-ac-(4-Cl-Phe)(1,2)-phe(3)-arg(6)-alanh2(10)- N-Ac-1,2-(4-Cl-Phe)-3-phe-6-arg-10-alanh2-LHRH Napp-paa

pdb file: 711245.pdb
sdf file: 711245.sdf
directory: 711245

85589-23-7 L-Alaninamide, L-leucyl-N-(2-(((5-(dimethylamino)-1-naphthalenyl)sulfonyl)amino)ethyl)- Leu-ala-ded Leucyl-alanyl-dansylethylenediamine

pdb file: 711319.pdb
sdf file: 711319.sdf
directory: 711319

85684-24-8 Ac-Somatotropin (7-13) HGH,alpha-acetyl (7-13)- Human growth hormone, N-alpha-acetyl (7-13)- L-Alanine, N-(N2-(N-(N-(N-(N2-(N-acetyl-L-seryl)-L-arginyl)-L-leucyl)-L-phenylalanyl)-L-alpha-aspartyl)-L-asparaginyl)- N(alpha)-Acetylsomatotropin (7-13) Nalpha-Acetylsomatotropin (7-13) Somatotropin, alpha-acetyl (7-13)-

pdb file: 711338.pdb
sdf file: 711338.sdf
directory: 711338

85807-50-7 Ala-gly-ser Alanyl-glycyl-serine

pdb file: 711353.pdb
sdf file: 711353.sdf
directory: 711353

85901-57-1 L-Leucinamide, 5-oxo-L-prolyl-L-phenylalanyl-N-(4-nitrophenyl)- Pglu-phe-leu-pna Pyroglutamyl-phenylalanyl-leucine-4-nitroanilide

pdb file: 711365.pdb
sdf file: 711365.sdf
directory: 711365

2-Ala-O-benzyl-5-ser-enkephalin 86248-85-3 Abs-enkephalin Enkephalin, ala(2)-O-benzyl-ser(5)- Enkephalin, alanyl(2)-O-benzylserine(5)- L-Serine, O-(phenylmethyl)-N-(N-(N-(N-L-tyrosyl-D-alanyl)glycyl)-L-phenylalanyl)-

pdb file: 711419.pdb
sdf file: 711419.sdf
directory: 711419

86356-77-6 L-Argininamide, D-phenylalanyl-L-prolyl-N-(3-carboxy-4-hydroxyphenyl)-, dihydrochloride PS 915 PS-915 Phe-pro-arg-cha Phenylalanyl-prolyl-arginyl-3-carboxy-4-hydroxyaniline

pdb file: 711449.pdb
sdf file: 711449.sdf
directory: 711449

86515-73-3 Hmt II 36-61 L-Alanine, L-cysteinyl-L-cysteinyl-L-prolyl-L-valylglycyl-L-cysteinyl-L-alanyl-L-lysyl-L-cysteinyl-L-alanyl-L-glutaminylglycyl-L-cysteinyl-L-isoleucyl-L-cysteinyl-L-lysylglycyl-L-alanyl-L-seryl-L-alpha-aspartyl-L-lysyl-L-cysteinyl-L-seryl-L-cysteinyl-L-cysteinyl- Metallothionein II hexacosapeptide 36-61

pdb file: 711986.pdb
sdf file: 711986.sdf
directory: 711986

(S)-N-((Phenylmethoxy)carbonyl)-L-alanyl-N-(3-chloro-2-oxo-1-(phenylmethyl)propyl)-L-alaninamide 86832-16-8 Benzyloxycarbonyl-ala-ala-phe-chloromethyl ketone Benzyloxycarbonylalanyl-alanyl phenylalanine chloromethyl ketone L-Alaninamide, N-((phenylmethoxy)carbonyl)-L-alanyl-N-(3-chloro-2-oxo-1-(phenylmethyl)propyl)-, (S)- Z-Ala-ala-phe-CH2CL

pdb file: 712029.pdb
sdf file: 712029.sdf
directory: 712029

3-Fluorophenylalanyl-alanyl-alanine 3-Fphe-ala-ala 87184-16-5 m-Fphe-ala-ala

pdb file: 712115.pdb
sdf file: 712115.sdf
directory: 712115

3-Chloroalanyl-3-chloroalanine 3-Cl-Ala-3-Cl-ala 87205-45-6 beta-Chloroalanyl-beta-chloroalanine

pdb file: 712120.pdb
sdf file: 712120.sdf
directory: 712120

87494-16-4 Ala-ser-gly Alanyl-seryl-glycine Glycine, N-(N-L-alanyl-L-seryl)-

pdb file: 712157.pdb
sdf file: 712157.sdf
directory: 712157

927-21-9 Alanylglycylglycine (DL)

pdb file: 712976.pdb
sdf file: 712976.sdf
directory: 712976

1188-01-8 N-DL-Alanylglycine

pdb file: 713206.pdb
sdf file: 713206.sdf
directory: 713206

1999-46-8 Alanylvaline (DL)

pdb file: 713595.pdb
sdf file: 713595.sdf
directory: 713595

87549-52-8 Ala-pro-arg-leu-arg-phe-tyr-ser-leu Alanyl-prolyl-arginyl-leucyl-arginyl-phenylalanyl-tyrosyl-seryl-leucine alpha-Bag cell peptide alpha-Bag cell peptide (Aplysia californica) alpha-Bcp alpha-Bcp(1-9)

pdb file: 713629.pdb
sdf file: 713629.sdf
directory: 713629

1-Ac-Trp-2-(4-Cl-phe)-3-trp-6-lys-10-alanh2-LHRH 1-Ac-Trp-2-cpa-3-trp-6-lys-10-alanh2-LHRH 87565-51-3 Ac-D-Trp(1,3)-D-cpa(2)-D-lys(6)-D-ala(10)-LH-RH Attcpl-LHRH D-Alaninamide, N-acetyl-D-tryptophyl-4-chloro-D-phenylalanyl-D-trptophyl-L-seryl-L-tyrosyl-D-lysyl-L-leucyl-L-arginyl-L-prolyl- D-Alaninamide, N-acetyl-D-tryptophyl-4-chloro-D-phenylalanyl-D-tryptophyl-L-seryl-L-tyrosyl-D-lysyl-L-leucyl-L-arginyl-L-prolyl-, (6R-(6alpha,7beta(Z)))- GNRH, N-Ac-trp(1)-(4-Cl-phe)(2)-trp(3)-lys(6)-alanh2(10)- LHRH, N-ac-Trp(1)-4-Cl-phe(2)-trp(3)-lys(6)-alanh(2)(10)- LHRH,-N-(Acetyltryptophyl)(1)-4-chlorophenylalanyl(2)-tryptophyl(3)-lysyl(6)-alaninamide(10)- MI 1544 MI-1544

pdb file: 713632.pdb
sdf file: 713632.sdf
directory: 713632

87619-62-3 H-Tyr-D-met(O)-phe-gly-NH2 SD 62 SD-62 Tyrosyl-methionyl-phenylalanyl-glycinamide

pdb file: 713643.pdb
sdf file: 713643.sdf
directory: 713643

87621-00-9 APNBH L-Prolinamide, L-alanyl-N-((4-nitrobenzoyl)oxy)-, (6R-(6alpha,7beta(Z)))- N-Ala-pro-O-(4-nitrobenzoyl)hydroxylamine N-Alanylproline-O-(4-nitrobenzoyl)hydroxylamine N-Alanylprolyl-O-(4-nitrobenzoyl)hydroxylamine

pdb file: 713646.pdb
sdf file: 713646.sdf
directory: 713646

2,5-Dichlorophenyl phosphorodichloridothioate 87668-61-9 Dcppdct Phosphorodichloridothioic acid, L-alanyl-N-((4-nitrobenzoyl)oxy)-, (6R-(6alpha,7beta(Z)))-

pdb file: 713658.pdb
sdf file: 713658.sdf
directory: 713658

87768-72-7 A-19009 Antibiotic A 19009 L-Alanine, N-L-alanyl-3-((4-amino-1,4-dioxo-2-butenyl)amino)-, (E)- N-(N(3)-Fumaramoyl-2,3-diaminopropanoyl)alanine

pdb file: 713670.pdb
sdf file: 713670.sdf
directory: 713670

87805-34-3 Glp-I (1-37) Glucagon-like peptide I (1-37) Glucagon-related peptide I (ox) Glycine, L-histidyl-L-alpha-aspartyl-L-alpha-glutamyl-L-phenylalanyl-L-alpha-glutamyl-L-arginyl-L-histidyl-L-alanyl-L-alpha-glutamylglycyl-L-threonyl-L-phenylalanyl-L-threonyl-L-seryl-L-alpha-aspartyl-L-valyl-L-seryl-L-seryl-L-tyrosyl-L-leucyl-L-alpha-glutamylglycyl-L-glutaminyl-L-alanyl-L-alanyl-L-lysyl-L-alpha-glutamyl-L-phenylalanyl-L-isoleucyl-L-alanyl-L-tryptophyl-L-leucyl-L-valyl-Llysylglycyl-L-arginyl-

pdb file: 713676.pdb
sdf file: 713676.sdf
directory: 713676

88090-55-5 Ala-ala-cys-mepda Alanylalanyl-S-(4-(N-(2-thioethyl))aminopyridine-2,6-dicarboxylic acid)cysteine L-Alanine, N-(N-L-alanyl-L-alanyl)-3-((2-((2,6-dicarboxy-4-pyridinyl)amino)ethyl)dithio)-

pdb file: 713706.pdb
sdf file: 713706.sdf
directory: 713706

(2,3-Dihydroxybenzoyl)-L-alanyl-L-threonine (2,3-Dihydroxybenzoyl)alanylthreonine 88167-28-6 Bu 2743E Bu-2743E L-Threonine, N-(N-(2,3-dihydroxybenzoyl)-L-alanyl)-

pdb file: 713722.pdb
sdf file: 713722.sdf
directory: 713722

2672-88-0 beta-Alanylglycine

pdb file: 714015.pdb
sdf file: 714015.sdf
directory: 714015

88331-14-0 BW 443C BW-443C L-Prolinamide, L-tyrosyl-D-arginylglycyl-4-nitro-L-phenylalanyl-, diacetate (salt) Tyr-arg-gly-(4-nitro-phe)-pro-NH2

pdb file: 716103.pdb
sdf file: 716103.sdf
directory: 716103

88389-69-9 L-Argininamide, L-valyl-L-alanyl-L-valylglycyl-L-alpha-glutamylglycyl-L-prolylglycyl-L-prolyl- Pomc (14-23) Pro-opiomelanocortin joining peptide(14-23) Protropin (14-23) Val-ala-val-gly-glu-gly-pro-gly-pro-arg

pdb file: 716798.pdb
sdf file: 716798.sdf
directory: 716798

19079-66-4 alpha-Alanylnorleucine (DL)

pdb file: 717380.pdb
sdf file: 717380.sdf
directory: 717380

19716-78-0 L-Alanine, N-(N-(N-(N-(1-oxodecyl)glycyl)-L-tryptophyl)-L-alanyl)-, methyl ester

pdb file: 717499.pdb
sdf file: 717499.sdf
directory: 717499

31944-64-6 L-Histidine, N-(N-(1-oxodecyl)-L-alanyl)-, methyl ester

pdb file: 718818.pdb
sdf file: 718818.sdf
directory: 718818

34322-87-7 beta-Alanyl-beta-alanine

pdb file: 719092.pdb
sdf file: 719092.sdf
directory: 719092

35146-63-5 L-Cysteine, s-(2-methoxy-2-oxoethyl)-N-(N-(N-(N-(1-oxopropyl)-L-phenylalanyl)-L-leucyl)glycyl)-, methyl ester

pdb file: 719166.pdb
sdf file: 719166.sdf
directory: 719166

55728-11-5 L-Alanine, N-(N-(N-(1-oxodecyl)-L-alanyl)-L-alanyl)-, methyl ester

pdb file: 720720.pdb
sdf file: 720720.sdf
directory: 720720

55728-12-6 L-Alanine, N-(N-(N-(1-oxodecyl)-L-alanyl)-L-leucyl)-, methyl ester

pdb file: 720721.pdb
sdf file: 720721.sdf
directory: 720721

55728-15-9 L-Serine, N-(N-(1-oxodecyl)-L-alanyl)-, methyl ester

pdb file: 720724.pdb
sdf file: 720724.sdf
directory: 720724

55728-17-1 L-Tryptophan, N-(N-(1-oxodecyl)-L-alanyl)-, methyl ester

pdb file: 720726.pdb
sdf file: 720726.sdf
directory: 720726

88467-45-2 L-Phenylalaninamide, N-(3-carboxy-1-oxopropyl)-L-alanyl-L-alanyl-L-prolyl-N-(4-methyl-2-oxo-2H-1-benzopyran-7-yl)- Suc-aapf-amc Succinyl-ala-ala-pro-phe-7-(4-methyl)coumarinyl-amide Succinyl-ala-ala-pro-phe-amc Succinyl-alanyl-alanyl-pro-phenylalanyl-7-amino-4-methylcoumarin Succinylalanylalanyl-prolyl-phenylalanine-4-methylcoumaryl-7-amide

pdb file: 723648.pdb
sdf file: 723648.sdf
directory: 723648

88500-51-0 DP-Papp L-Proline, 1-(1-(N-(bis(phenylmethoxy)phosphinyl)-L-alanyl)-L-prolyl)- N-(Dibenzyloxyphosphinoyl)alanyl-prolyl-proline N-Dibenzyloxyphosphinyl-ala-pro-pro

pdb file: 723651.pdb
sdf file: 723651.sdf
directory: 723651

88847-78-3 L-Leucine, N-(N-(1-(N-(N-L-tyrosyl-L-methionyl)glycyl)-L-prolyl)-L-phenylalanyl)- N-(N-(1-(N-(N-L-Tyrosyl-L-methionyl)glycyl)-L-prolyl)-L-phenylalanyl)-L-leucine Phorphin

pdb file: 723696.pdb
sdf file: 723696.sdf
directory: 723696

(Tri-ala)isonicotinic acid hydrazide 88874-01-5 L-Alanine, N-(N-L-alanyl-L-alanyl)-, 2-(4-pyridinylcarbonyl)hydrazide, dihydrochloride N-(Alanyl-alanyl-alanyl)isonicotinic acid hydrazide N-(Trialanyl)isonicotinic acid hydrazide TAIAH

pdb file: 723700.pdb
sdf file: 723700.sdf
directory: 723700

88932-75-6 Benzenepropanamide, alpha-amino-N-3-pyridinyl-, (S)- L-Phenylalanyl-3-aminopyridine Phenylalanyl-3-aminopyridine

pdb file: 723708.pdb
sdf file: 723708.sdf
directory: 723708

89026-15-3 F-Met-aib-phe Formylmethionyl-alpha-aminoisobutyryl-phenylalanine L-Phenylalanine, N-(N-(N-formyl-L-methionyl)-2-methylalanyl)- N-Formyl-met-aib-phe

pdb file: 723728.pdb
sdf file: 723728.sdf
directory: 723728

4-(4'-Bromo-phe)-leu-enkephalin 89705-56-6 Enkephalin-leu, 4'-bromo-phe(4)- Enkephalin-leu, 4'-bromophenylalanine(4)- L-Leucine, N-(4-bromo-N-(N-(N-L-tyrosylglycyl)glycyl)-L-phenylalanyl)- LEBP Leu-enkephalin, 4'-bromo-phe(4)- Leucine-enkephalin, 4'-bromo-phe(4)-

pdb file: 723818.pdb
sdf file: 723818.sdf
directory: 723818

4-(4'-Bromo phe)-met-enkephalin 89705-57-7 Enkephalin-met, 4'-bromo-phe(4)- Enkephalin-met, 4'-bromophenylalanine(4)- L-Methionine, N-(4-bromo-N-(N-(N-L-tyrosylglycyl)glycyl)-L-phenylalanyl)- MEBP Met-enkephalin, 4'-bromo-phe(4)- Methionine-enkephalin, 4'-bromo-phe(4)-

pdb file: 723819.pdb
sdf file: 723819.sdf
directory: 723819

2-Butenoic acid, 4-((2-(acetylamino)-1-oxo-3-phenylpropyl)amino)-, (2S-trans)- 4-((N-Acetylphenylalanyl)amino)-but-2-enoic acid methyl ester 89711-04-6 Mapheb Methyl 4-((N-acetylphenylalanyl)amino)but-2-enoate

pdb file: 723823.pdb
sdf file: 723823.sdf
directory: 723823

90068-11-4 Uaaapne Ude-asp-(ala)2-pro-nhet Undecenoyl-aspartyl-dialanyl-proline ethylamide

pdb file: 723869.pdb
sdf file: 723869.sdf
directory: 723869

90145-64-5 H 189 H-189 L-Lysine, N2-(N-(N-(N-(3-hydroxy-6-methyl-1-oxo-4-((N-(N-(1-(N-L-prolyl-L-histidyl)-L-prolyl)-L-phenylalanyl)-L-histidyl)amino)heptyl)-L-valyl)-L-isoleucyl)-L-histidyl)-, (S-(R*,R*))-

pdb file: 723877.pdb
sdf file: 723877.sdf
directory: 723877

90331-82-1 L-Leucine, N-(N2-(4-nitro-N-(N-(N-(N-L-prolyl-L-threonyl)-L-alpha-glutamyl)-L-phenylalanyl)-L-phenylalanyl)-L-arginyl)-, (2'E)- Pro-thr-glu-phe-4-nitro-phe-arg-leu Prolyl-threonyl-glutamyl-phenylalanyl-4-nitrophenylalanyl-arginyl-leucine Ptgp-NP-AL

pdb file: 723898.pdb
sdf file: 723898.sdf
directory: 723898

90549-83-0 Tyr-arg-phe-gly-OH Tyrosyl-arginyl-phenylalanyl-glycine

pdb file: 723943.pdb
sdf file: 723943.sdf
directory: 723943

90549-84-1 Glycine, N-(N-(N2-L-tyrosyl-D-arginyl)-L-phenylalanyl)-, ethyl ester H-Tyr-arg-phe-gly-oet Tdapge Tyrosyl-arginyl-phenylalanyl-glycine ethyl ester

pdb file: 723944.pdb
sdf file: 723944.sdf
directory: 723944

1-Ecppap 90940-59-3 N-(1-(Ethoxycarbonyl)-3-phenylpropyl)-alanyl-pyroglutamic acid

pdb file: 723988.pdb
sdf file: 723988.sdf
directory: 723988

90986-81-5 Glycine, N-(N-(5-oxo-L-prolyl)-L-phenylalanyl)-, erythro- Pglu-phe-gly Pglu-phe-gly-OH Pyroglutamyl-phenylalanyl-glycine

pdb file: 724008.pdb
sdf file: 724008.sdf
directory: 724008

90991-75-6 Cpe-ala-ala-phe-pab Cpp-ala-ala-phe-pab L-Phenylalaninamide, N-(1-carboxy-2-phenylethyl)-L-alanyl-L-alanyl-N-(4-carboxyphenyl)- N-(1-Carboxy-2-phenylethyl)-alanyl-alanyl-phenylalanine-4-aminobenzoate

pdb file: 724015.pdb
sdf file: 724015.sdf
directory: 724015

91853-94-0 L-Threonine, N-(N2-(N-L-phenylalanyl-L-tryptophyl)-L-lysyl)-, (Z,E,E,E,E)- Phe-trp-lys-thr Phenylalanyl-tryptophyl-lysyl-threonine Somatostatin(7-10)

pdb file: 724077.pdb
sdf file: 724077.sdf
directory: 724077

92121-46-5 L-Alaninamide, N-acetyl-L-alanyl-L-alanyl-N-(4-((7-((5-(acetylamino)-5-carboxy-1-oxopentyl)amino)-2-carboxy-7-(formylamino)-8-oxo-5-thia-1-azabicyclo(4.2.0)oct-2-en-3-yl)methoxy)-1-(3-((aminoiminomethyl)amino)propyl)-2-hydroxy-4-oxobutyl)- SQ 28516 SQ-28516

pdb file: 724089.pdb
sdf file: 724089.sdf
directory: 724089

4-(Hydroxymethylphosphinyl)-L-2-aminobutanoyl-L-alanyl-L-leucine 92567-89-0 L-Leucine, 4-(hydroxymethylphosphinyl)-L-2-aminobutanoyl-L-alanyl- L-Leucine, gamma-(hydroxymethylphosphinyl)-L-alpha-aminobutyryl-L-alanyl- Phosalacine

pdb file: 724105.pdb
sdf file: 724105.sdf
directory: 724105

92759-01-8 Ethyltyrosyl-arginyl-phenylalanyl-glycine ethyl ester Glycine, N-(N-(N2-(O-ethyl-L-tyrosyl)-D-arginyl)-L-phenylalanyl)-, trans- H-Tyr(Et)-D-arg-phe-gly-oet Tedapge

pdb file: 724116.pdb
sdf file: 724116.sdf
directory: 724116

92891-56-0 Ige C-terminal nonapeptide Igercine L-Lysine, N2-(N-(1-(N2-(N-(N-(N-(N-L-arginyl-L-alanyl)-L-valyl)-L-seryl)-L-valyl)-L-asparaginyl)-L-prolyl)glycyl)-

pdb file: 724122.pdb
sdf file: 724122.sdf
directory: 724122

92892-92-7 Glycine, N-(N-(1-(ethoxycarbonyl)-3-phenylpropyl)-L-alanyl)-N-(2-ethoxyethoxy)-, (S)- N-(N-(1-(Ethoxycarbonyl)-3-phenylpropyl)alanyl)-N-(2-ethoxyethoxy)glycine Rev 6134 Rev-6134

pdb file: 724123.pdb
sdf file: 724123.sdf
directory: 724123

93287-54-8 Cgp 29287 Cgp-29,287 L-Lysine, N6-((1,1-dimethylethoxy)carbonyl)-N2-(N-(N-(3-hydroxy-6-methyl-1-oxo-4-((N-(N-(1-(N2-(N2-((phenylmethoxy)carbonyl)-L-arginyl)-L-arginyl)-L-prolyl)-L-phenylalanyl)-L-histidyl)amino)heptyl)-L-isoleucyl)-L-histidyl)-, methyl ester, (S-(R*,R*))-

pdb file: 724142.pdb
sdf file: 724142.sdf
directory: 724142

93511-94-5 Aalasgppv Arg-arg-lys-ala-ser-gly-pro-pro-val Arginyl-arginyl-lysyl-alanyl-seryl-glycyl-prolyl-prolyl-valine L-Valine, N-(1-(1-(N-(N-(N-(N2-(N2-L-arginyl-L-arginyl)-L-lysyl)-L-alanyl)-L-seryl)glycyl)-L-prolyl)-L-prolyl)-, (3beta)-

pdb file: 724170.pdb
sdf file: 724170.sdf
directory: 724170

93675-09-3 Cgapsgptgal Glu-asn-pro-ser-gln-phe-tyr-glu-arg-leu-cys-NH2 Glutamyl-asparaginyl-prolyl-seryl-glutaminyl-phenylalanyl-tyrosyl-glutamyl-arginyl-leucyl-cysteinamide L-Leucine, N-(N2-(N-(N-(N-(N2-(N-(1-(N2-(N-L-cysteinyl-L-alpha-glutamyl)-L-asparaginyl)-L-prolyl)-L-seryl)-L-glutaminyl)-L-phenylalanyl)-L-tyrosyl)-L-alpha-glutamyl)-L-arginyl)-, (R-(R*,S*-(E)))- Syncytiotrophoblastic polypeptide

pdb file: 724494.pdb
sdf file: 724494.sdf
directory: 724494

93909-73-0 Cgp 31362 Cgp-31362 Glycinamide, S-(2,3-(bis(1-oxododecyl)oxy)propyl)-N-(1-oxohexadecyl)-L-cysteinyl-L-alanyl-D-alpha-glutaminyl-N-(2-sulfoethyl)-, monosodium slat, (R)- N-Hexadecanoyl-S-(2,3-didodecanoyloxypropyl)-cysteinyl-alanyl-isoglutaminyl-glycyl-taurine

pdb file: 724513.pdb
sdf file: 724513.sdf
directory: 724513

94152-60-0 L-Glutamic acid, N-(N2-(1-(N-(N-(N-(1-(N2-L-seryl-L-asparaginyl)-L-prolyl)-L-alanyl)-L-methionyl)-L-alanyl)-L-prolyl)-L-arginyl)-, (9alpha,11alpha,13E,15S)- SS25(1-9) Somatostatin 25-(1-9)

pdb file: 724525.pdb
sdf file: 724525.sdf
directory: 724525

94162-23-9 Isovaleryl-histidyl-prolyl-phenylalanyl-histidyl-statine-leucyl-phenylalanine Iva-his-pro-phe-his-sta-leu-phe-NH2 L-Phenylalaninamide, N-(3-hydroxy-4-((N-(N-(1-(N-L-isovalyl-L-histidyl)-L-prolyl)-L-phenylalanyl)-L-histidyl)amino)-6-methyl-1-oxoheptyl)-L-isoleucyl-, (S-(R*,R*))- Renin inhibitory peptide, statine SCRIP

pdb file: 724527.pdb
sdf file: 724527.sdf
directory: 724527

94242-92-9 AAPbV Boroval L-Prolinamide, N-(4-methoxy-1,4-dioxobutyl)-L-alanyl-L-alanyl-N-(2-methyl-1-(4,4,5,5-tetramethyl-1,3,2-dioxaborolan-2-yl)propyl)- Meosuc-ala-ala-pro-boroval-pinacol Methyl-O-succinyl-alanyl-alanyl-prolyl-borovaline-pinacol

pdb file: 724530.pdb
sdf file: 724530.sdf
directory: 724530

94345-34-3 Anf (1-16) Anp (1-16) Atrial natriuretic factor (1-16) Atriopeptin (1-16) Cardionatrin I (1-16) L-Arginine, L-leucyl-L-alanylglycyl-L-prolyl-L-arginyl-L-seryl-L-leucyl-L-arginyl-L-arginyl-L-seryl-L-seryl-L-cysteinyl-L-phenylalanylglycylglycyl-, (S)-

pdb file: 724538.pdb
sdf file: 724538.sdf
directory: 724538

94495-17-7 Cad1 bacterial sex hormone Glycine, N-(N-(N-(N-(N-(N-(N-L-leucyl-L-phenylalanyl)-L-seryl)-L-leucyl)-L-valyl)-L-leucyl)-L-alanyl)- Leu-phe-ser-leu-val-leu-ala-gly-OH Leucyl-phenylalanyl-seryl-leucyl-valyl-leucyl-alanyl-glycine Sex hormone cad1, streptococcus faecalis Sex pheromone cad1

pdb file: 724549.pdb
sdf file: 724549.sdf
directory: 724549

95034-26-7 L-Phenylalanine, N-(N-(N-(N-(N-(N-(1-(N-L-prolyl-L-histidyl)-L-prolyl)-L-phenylalanyl)-L-histidyl)-L-leucyl)-L-phenylalanyl)-L-valyl)- Pro-his-pro-phe-his-leu-phe-val-phe RI 61 RI-61

pdb file: 724592.pdb
sdf file: 724592.sdf
directory: 724592

97399-67-2 Boc-leu-ala-leu-ala-leu-trp Boclalalw tert-Butyloxycarbonyl-leucyl-alanyl-leucyl-alanyl-leucyl-tryptophan

pdb file: 724650.pdb
sdf file: 724650.sdf
directory: 724650

100111-08-8 H 256 H-256 H256 L-Glutamic acid, N-(N2-(N-(3-phenyl-2-((N-(N-L-prolyl-L-threonyl)-L-alpha-glutamyl)amino)propyl)-L-phenylalanyl)-L-arginyl)-, (S)- Pro-thr-glu-phe-CH2NH-phe-arg-glu

pdb file: 724678.pdb
sdf file: 724678.sdf
directory: 724678

100307-95-7 2-Aminobenzoyl-ala-gly-leu-ala-4-nitrobenzylamide 2-Aminobenzoylalanyl-glycyl-leucyl-alanyl-4-nitrobenzylamide Aaglan Abz-ala-gly-leu-ala-nba L-Alaninamide, N-(2-aminobenzoyl)-L-alanylglycyl-L-leucyl-N-((4-nitrophenyl)methyl)-, (6aS-(6aalpha,7alpha,8beta,9aalpha))-

pdb file: 724679.pdb
sdf file: 724679.sdf
directory: 724679

100642-98-6 Boc-leu(4)-aib-leu(4)-obzl L-Leucine, N-(N-(N-(N-(N-(N-(N-(N-(N-((1,1-dimethylethoxy)carbonyl)-L-leucyl)-L-leucyl)-L-leucyl)-L-leucyl)-2-methylalanyl)-L-leucyl)-L-leucyl)-L-leucyl)-, phenylmethyl ester tert-Butoxycarbonylleucyl-leucyl-leucyl-leucyl-aminoisobutyryl-leucyl-leucyl-leucyl-leucine benzyl ester

pdb file: 724680.pdb
sdf file: 724680.sdf
directory: 724680

101559-44-8 BW 633C BW-633-C His-pro-phe-his-leu-(AA)-val-ile-phe-ome L-Phenylalanine, N-(N-(N-(3-((N-(N-(1-L-histidyl-L-prolyl)-L-phenylalanyl)-L-histidyl)amino)-2-hydroxy-5-methylhexyl)-L-valyl)-L-isoleucyl)-, methyl ester

pdb file: 724712.pdb
sdf file: 724712.sdf
directory: 724712

102380-93-8 Gliadin peptide B 3142 (23-53) Gliadin peptide CT-2 L-Tyrosine, L-valyl-L-glutaminyl-L-glutaminyl-L-glutaminyl-L-glutaminyl-L-phenylalanyl-L-prolylglycyl-L-glutaminyl-L-glutaminyl-L-glutaminyl-L-prolyl-L-phenylalanyl-L-prolyl-L-prolyl-L-glutaminyl-L-glutaminyl-L-prolyl-L-tyrosyl-L-prolyl-L-glutaminyl-L-prolyl-L-glutaminyl-L-prolyl-L-phenylalanyl-L-prolyl-L-seryl-L-glutaminyl-L-glutaminyl-L-prolyl- L-Valyl-L-glutaminyl-L-glutaminyl-L-glutaminyl-L-glutaminyl-L-phenylalanyl-L-prolylglycyl-L-glutaminyl-L-glutaminyl-L-glutaminyl-L-prolyl-L-phenylalanyl-L-prolyl-L-prolyl-L-glutaminyl-L-glutaminyl-L-prolyl-L-tyrosyl-L-prolyl-L-glutaminyl-L-prolyl-L-glutaminyl-L-prolyl-L-phenylalanyl-L-prolyl-L-seryl-L-glutaminyl-L-glutaminyl-L-prolyl-L-tyrosine

pdb file: 724755.pdb
sdf file: 724755.sdf
directory: 724755

102989-34-4 H-His-lys-thr-asp-ser-phe-val-gly-leu-met-OH L-Methionine, N-(N-(N-(N-(N-(N-(N-(N-(N2-L-histidyl-L-lysyl)-L-threonyl)-L-alpha-aspartyl)-L-seryl)-L-phenylalanyl)-L-valyl)glycyl)-L-leucyl)- Neurokinin A-OH Nka-OH

pdb file: 724761.pdb
sdf file: 724761.sdf
directory: 724761

104531-07-9 Cpap-E N-(1(S)-Carboxy-(4-OH-3-(125)iodopheny)ethyl)-ala-pro N-(1(S)-Carboxy-(4-OH-3-iodophenyl)ethyl)-ala-pro N-(1(S)-Carboxy-(4-hydroxy-3-iodophenyl)ethyl)-alanylproline

pdb file: 724783.pdb
sdf file: 724783.sdf
directory: 724783

105250-85-9 Glycine, N-(N-(N-(N-L-tyrosylglycyl)-L-phenylalanyl)glycyl)- Historphin Tyr-gly-phe-gly-gly Tyrosyl-glycyl-phenylalanyl-glycyl-glycine

pdb file: 724798.pdb
sdf file: 724798.sdf
directory: 724798

107573-17-1 Ala-phe-lys-CH2F Alanyl-phenylalanyl-lysine fluoromethane

pdb file: 724838.pdb
sdf file: 724838.sdf
directory: 724838

107573-16-0 Benzoylphenylalanyllysine fluoromethane Bz-Phe-lys-CH2F

pdb file: 724839.pdb
sdf file: 724839.sdf
directory: 724839

107658-43-5 GALA L-Alanine, L-tryptophyl-L-alpha-glutamyl-L-alanyl-L-alanyl-L-leucyl-L-alanyl-L-alpha-glutamyl-L-alanyl-L-leucyl-L-alanyl-L-alpha-glutamyl-L-alanyl-L-leucyl-L-alanyl-L-alpha-glutamyl-L-histidyl-L-leucyl-L-alanyl-L-alpha-glutamyl-L-alanyl-L-leucyl-L-alanyl-L-alpha-glutamyl-L-alanyl-L-leucyl-L-alpha-glutamyl-L-alanyl-L-leucyl-L-alanyl- L-Tryptophyl-L-alpha-glutamyl-L-alanyl-L-alanyl-L-leucyl-L-alanyl-L-alpha-glutamyl-L-alanyl-L-leucyl-L-alanyl-L-alpha-glutamyl-L-alanyl-L-leucyl-L-alanyl-L-alpha-glutamyl-L-histidyl-L-leucyl-L-alanyl-L-alpha-glutamyl-L-alanyl-L-leucyl-L-alanyl-L-alpha-glutamyl-L-alanyl-L-leucyl-L-alpha-glutamyl-L-alanyl-L-leucyl-L-alanyl-L-alanine

pdb file: 724845.pdb
sdf file: 724845.sdf
directory: 724845

107889-42-9 Phe-ala-lys Phenylalanyl-alanyl-lysine

pdb file: 724852.pdb
sdf file: 724852.sdf
directory: 724852

107910-43-0 Adggaim N-(2-Acetamido-2,3-dideoxyglucopyranos-3-yl)glycyl-alanyl-isoglutamine methyl ester

pdb file: 724853.pdb
sdf file: 724853.sdf
directory: 724853

119777-90-1 CF3-Leu-ala-NH-C6H4-CF3 TFLA Trifluoroacetyl-leucyl-alanyl-4-trifluoromethylanilide

pdb file: 725556.pdb
sdf file: 725556.sdf
directory: 725556

119798-87-7 Glycine, N-(N-(N-(1-(1-(3-(4-hydroxyphenyl)-1-oxopropyl)-L-prolyl)-L-prolyl)glycyl)-L-alanyl)- N-3-(4-Hydroxyphenyl)propionyl-pro-pro-gly-ala-gly N-3-(4-Hydroxyphenyl)propionyl-prolyl-prolyl-glycyl-alanyl-glycine Nhp-ppgag

pdb file: 725653.pdb
sdf file: 725653.sdf
directory: 725653

1-Nal-5,8-(thi-ala)-7-phe-bradykinin 119953-19-4 Bradykinin, nal(1)-(thi-ala)(5,8)-phe(7)- Bradykinin, naphthyl(1)-thienylalanyl(5,8)-phenylalanine(7)- L-Alanine, N-(N-(N-(N-(N-(1-(1-(3-(2-naphthalenyl)-D-alanyl)-L-prolyl)-L-prolyl)glycyl)-3-(2-thienyl)-L-alanyl)-L-seryl)-D-phenylalanyl)-3-(2-thienyl)- Npc 573 Npc-573

pdb file: 725730.pdb
sdf file: 725730.sdf
directory: 725730

38236-39-4 L-Glutamic acid, N-(N-(N-(1-(ethoxycarbonyl)-2-propenyl)-L-alanyl)-L-alpha-glutamyl)-, 1-(2-oxo-2-phenylethyl) 5,5'-bis(phenylmethyl) ester

pdb file: 725926.pdb
sdf file: 725926.sdf
directory: 725926

52162-12-6 L-Alanyl-L-argininamide L-Argininamide, L-alanyl-

pdb file: 726220.pdb
sdf file: 726220.sdf
directory: 726220

52162-13-7 Glycine, N-(N2-L-alanyl-L-arginyl)- N-(N2-L-Alanyl-L-arginyl)glycine

pdb file: 726221.pdb
sdf file: 726221.sdf
directory: 726221

52162-14-8 Glycinamide, N-benzoyl-L-alanyl-L-arginyl- N-Benzoyl-L-alanyl-L-arginylglycinamide

pdb file: 726222.pdb
sdf file: 726222.sdf
directory: 726222

52977-61-4 O-(N-Methyl-N-nitroso-beta-alanyl)-L-serine O-(N-Methyl-N-nitroso-beta-alanyl)-serine O-(N-Nitroso-N-methyl-beta-alanyl)-L-serine Serine, O-(N-methyl-N-nitroso-beta-alanyl)-, L-

pdb file: 726257.pdb
sdf file: 726257.sdf
directory: 726257

106-Dephenylalanyl-107-deglycyl-115-dearginyl-116-deglutamine-atriopeptin (103-126) 121051-68-1 Anf (103-126), de-phe(106)-de-gly(107)-de-ala(115)-de-gln(116)- Anp (103-126), de-phenylalanyl(106)-de-glycyl(107)-de-alanyl(5)-de-glutamine(116)- Atrial natriuretic factor (103-126), des-phe(106)-des-gly(107)-des-ala(115)-des-gln(116)- Atriopeptin (103-126), des-phe(106)-des-gly(107)-des-ala(115)-des-gln(116)- Atriopeptin-21 (rat reduced), 4-de-L-phenylalanine-5-deglycine-13-de-L-alanine-14-de-L-glutamine-21a-L-phenylalanine-21b-L-arginine-21c-L-tyrosine- SC 46542 SC-46542

pdb file: 726790.pdb
sdf file: 726790.sdf
directory: 726790

12584-58-6 184890-24-2 8A-L-Threonine-10A-L-isoleucineinsulin (ox) 9004-14-2 97380-49-9 EINECS 235-703-3 Hog insulin Insulin (Alopex lagopus) Insulin (Canis familiaris) Insulin (Ox), 8A-L-threonine-10A-L-isoleucine- (9CI) Insulin (Physeter catodon) Insulin (dog) Insulin (ox) Insulin (ox), 8(sup A)-L-threonine-10(sup A)-L-isoleucine- Insulin (ox), 8A-l-threonine-10A-l-isoleucine- Insulin (pig) Insulin (porcine) Insulin (sperm whale) Insulin (swine) Insulin [USAN:JAN] Insulin porcine Insulin, 8A-L-threonine-10A-L-isoleucine- Insulin, neutral Insulin,pig L-Alanine, L-phenylalanyl-L-valyl-L-asparaginyl-L-glutaminyl-L-histidyl-L-leucyl-L-cysteinylglycyl-L-seryl-L-histidyl-L-leucyl-L-valyl-L-alpha-glutamyl-L-alanyl-L-leucyl-L-tyrosyl-L-leucyl-L-valyl-L-cysteinylglycyl-L-alpha-glutamyl-L-arginylglycyl-L-phenylalanyl-L-phenylalanyl-L-tyrosyl-L-threonyl-L-prolyl-L-lysyl-, cyclic (7-7'),(19-20')-bis(disulfide) with glycyl-L-isoleucyl-L-valyl-L-alpha-glutamyl-L-glytaminyl-L-cysteinyl-L-cysteinyl-L-threonyl-L-seryl-L-isolucyl-L-cysteinyl-L-seryl-L-leucyl-L-tyrosyl-L-glutaminyl-L-leucyl-L-alpha-glutamyl-L-asparaginyl-L-tyrosyl-L-cysteinyl-L-asparagine cyclic (6'-11')-disulfide Neutral insulin Pig insulin Porcine insulin Swine insulin Velosulin

pdb file: 727441.pdb
sdf file: 727441.sdf
directory: 727441

82896-63-7 Glycinamide, N-9-acridinyl-beta-alanyl-N-(3-((N-(N-9-acridinyl-beta-alanyl)glycyl)amino)propyl)- N-9-Acridinyl-beta-alanyl-N-(3-((N-(N-9-acridinyl-beta-alanyl)glycyl)amino)propyl)glycinamide

pdb file: 727594.pdb
sdf file: 727594.sdf
directory: 727594

75539-83-2 Glycine, N-(N-D-phenylalanyl-L-phenylalanyl)- Phe-phe-gly Phenylalanyl-phenylalanyl-glycine

pdb file: 728160.pdb
sdf file: 728160.sdf
directory: 728160

1238-09-1 21500-54-9 L-Arginine, N2-L-phenylalanyl- Phe-arg Phenylalanylarginine

pdb file: 728435.pdb
sdf file: 728435.sdf
directory: 728435

2990-43-4 L-Methioninamide, L-lysyl-L-phenylalanyl-L-isoleucylglycyl-L-leucyl- Lpiglm Lys-phe-ile-gly-leu-met-amide Lysyl-phenylalanyl-isoleucyl-glycyl-leucyl-methioninamide

pdb file: 728596.pdb
sdf file: 728596.sdf
directory: 728596

256475-21-5 Iseganan hydrochloride L-Argininamide, L-arginylglycylglycyl-L-leucyl-L-cysteinyl-L-tyrosyl-L-cysteinyl-L-arginylglycyl-L-arginyl-L-phenylalanyl-L-cysteinyl-L-valyl-L-cysteinyl-L-valylglycyl-, cyclic (5-14),(7-12)-bis(disulfide), hydrochloride

pdb file: 728617.pdb
sdf file: 728617.sdf
directory: 728617

3617-45-6 4159-71-1 L-Glutamic acid, N-L-phenylalanyl- Phe-glu Phenylalanylglutamate

pdb file: 728674.pdb
sdf file: 728674.sdf
directory: 728674

3918-87-4 L-Alanine, N-L-phenylalanyl- L-Phenylalanyl-L-alanine Phe-ala Phenylalanylalanine

pdb file: 728721.pdb
sdf file: 728721.sdf
directory: 728721

257277-05-7 IB 367 Iseganan Iseganan [INN] L-Argininamide, L-arginylglycylglycyl-L-leucyl-L-cysteinyl-L-tyrosyl-L-cysteinyl-L-arginylglycyl-L-arginyl-L-phenylalanyl-L-cysteinyl-L-valyl-L-cysteinyl-L-valylglycyl-, cyclic (5-14),(7-12)-

pdb file: 728734.pdb
sdf file: 728734.sdf
directory: 728734

4909-43-7 Bocadchu Carbamic acid, (2-(cyclohexyl((cyclohexylamino)carbonyl)amino)-1-methyl-2-oxoethyl)-, 1,1-dimethylethyl ester, (S)- N-(N(alpha)-(t-Butyloxycarbonyl)-L-alanyl)-N,N'-dicyclohexylurea N-(N(alpha)-(tert-Butyloxycarbonyl)alanyl)-N,N'-dicyclohexylurea

pdb file: 728777.pdb
sdf file: 728777.sdf
directory: 728777

60254-83-3 CCRIS 2597 Enkephalin-leu, des-tyr(1)- N-(N-(N-Glycylglycyl)-L-phenylalanyl)-L-leucine

pdb file: 729163.pdb
sdf file: 729163.sdf
directory: 729163

13082-29-6 L-Phenylalanine, N-L-phenylalanyl-, methyl ester Phe-phe-ome Phenylalanylphenylalanine methyl ester

pdb file: 729271.pdb
sdf file: 729271.sdf
directory: 729271

16088-00-9 L-Alanine, N-(N-((phenylmethoxy)carbonyl)-D-phenylalanyl)- N(alpha)-Benzyloxycarbonyl-D-phenylalanyl-L-alanine N-Benzyloxycarbonylphenylalanylalanine Z-Phe-ala

pdb file: 729662.pdb
sdf file: 729662.sdf
directory: 729662

16874-81-0 His-phe Histidylphenylalanine L-Phenylalanine, N-L-histidyl- Phe-his Phenylalanylhistidine

pdb file: 729728.pdb
sdf file: 729728.sdf
directory: 729728

17195-26-5 32203-96-6 L-Valine, N-(N-(N-L-leucyl-L-alanyl)glycyl)- Leu-ala-gly-val Leucyl-alanyl-glycyl-valine

pdb file: 729739.pdb
sdf file: 729739.sdf
directory: 729739

19993-26-1 Ac-D-Ala-D-ala Acetyl-D-alanyl-D-alanine Acetyl-ala-ala Acetylalanylalanine D-Alanine, N-(N-acetyl-D-alanyl)-

pdb file: 729810.pdb
sdf file: 729810.sdf
directory: 729810

63519-99-3 L-Valine, N-((phenylmethoxy)carbonyl)-D-seryl-L-alanyl-S-((acetylamino)methyl)-L-cysteinyl-, bimol. (4-

pdb file: 729896.pdb
sdf file: 729896.sdf
directory: 729896

63520-00-3 L-Valine, N-((phenylmethoxy)carbonyl)-D-seryl-L-alanyl-L-cysteinyl-,bimol. (4-

pdb file: 729897.pdb
sdf file: 729897.sdf
directory: 729897

23576-42-3 Glycine, N-(N-L-phenylalanylglycyl)- Phe-gly-gly Phenylalanyl-glycyl-glycine

pdb file: 730157.pdb
sdf file: 730157.sdf
directory: 730157

24570-39-6 24570-65-8 Ac2-Lys-ala-ala D-Alanine, N-(N-(N2,N6-diacetyl-L-lysyl)-D-alanyl)- Diacetyl-L-lysyl-D-alanyl-D-alanine N(alpha),N(epsilon)-Diacetyl-lys-ala-ala N(alpha),N-(epsilon)-diacetyl-lysyl-alanyl-alanine

pdb file: 730191.pdb
sdf file: 730191.sdf
directory: 730191

30802-31-4 L-Alaninamide, N-acetyl-L-alanyl-L-prolyl- N-Ac-Ala-pro-ala-amide N-Acetyl-alanyl-prolyl-alaninamide

pdb file: 731130.pdb
sdf file: 731130.sdf
directory: 731130

5,12-Naphthacenedione, 8-acetyl-7,8,9,10-tetrahydro-6,8,11-trihydroxy-1-methoxy-10-((2,3,6-trideoxy-3-((N-L-leucyl-L-alanyl)amino)-alpha-L-xylo-hexopyranosyl)oxy)-, monohydrochloride, (8S-cis)- 74853-79-5 8-Acetyl-7,8,9,10-tetrahydro-6,8,11-trihydroxy-1-methoxy-10-((2,3,6-trideoxy-3-((N-L-leucyl-L-alanyl)amino)-alpha-L-xylo-hexopyranosyl)oxy)-5,12-naphthacenedione monohydrochloride, (8S-cis)-

pdb file: 731139.pdb
sdf file: 731139.sdf
directory: 731139

5,12-Naphthacenedione, 8-acetyl-10-((3-((N-L-alanyl-L-leucyl)amino)-2,3,6-trideoxy-alpha-L-xylo-hexopyranoxyl)oxy)-7,8,9,10-tetrahydro-6,8,11-trihydroxy-1-methoxy-, monohydrochloride, (8S-cis)- 74853-81-9 Ala-leu-daunorubicin Alanylleucyl-daunorubicin

pdb file: 731141.pdb
sdf file: 731141.sdf
directory: 731141

68762-78-7 Acetyldehydro-3-(2-thienyl)-ala-tyr Acetyldehydro-3-(2-thienyl)alanyltyrosine L-Tyrosine, N-(N-acetyl-2,3-didehydro-3-(2-thienyl)alanyl)- N-(2-Acetylamino-3-(2-thienyl)-2-propenoyl)tyrosine

pdb file: 732543.pdb
sdf file: 732543.sdf
directory: 732543

71142-71-7 D-Phe-pro-arg CH2Cl D-Phenylalanine-proline-arginine methyl chloride L-Prolinamide, D-phenylalanyl-N-(4-((aminoiminomethyl)amino)-1-(chloroacetyl)butyl)-, (S)- PPACK Phe-pro-arg-methyl chloride Phenylalanyl-prolyl-arginine methyl chloride

pdb file: 733036.pdb
sdf file: 733036.sdf
directory: 733036

71732-53-1 Benzyloxycarbonylphenylalanylalanine diazomethyl ketone Carbamic acid, ((1S)-2-(((1S)-3-diazo-1-methyl-2-oxopropyl)amino)-2-oxo-1-(phenylmethyl)ethyl)-, phenylmethyl ester, (S-(R*,R*))- Carbamic acid, (2-((3-diazo-1-methyl-2-oxopropyl)amino)-2-oxo-1-(phenylmethyl)ethyl)-, phenylmethyl ester, (S-(R*,R*))- Carbobenzoxycarbonyl-L-phenylalanyl-L-alanine-D-diazomethane Z-Phe-ala-diazomethane

pdb file: 733068.pdb
sdf file: 733068.sdf
directory: 733068

73072-90-9 D-Glutamic acid, N-(N-(N-acetylmuramoyl)-L-alanyl)-, 5-decyl 1-methyl ester

pdb file: 733342.pdb
sdf file: 733342.sdf
directory: 733342

73165-63-6 Pirakril Pyracryl beta-Alanine, N-(N-(1-oxo-2-propenyl)-beta-alanyl)-, 3-pyridinyl ester, N-oxide, polymer with N-(2-hydroxy-1,1-bis(hydroxymethyl)ethyl)-2-propenamide and N,N'-methylenebis(2-propenamide)

pdb file: 733502.pdb
sdf file: 733502.sdf
directory: 733502

71591-31-6 L-Leucinamide, L-tyrosylglycylglycyl-L-phenylalanyl-N-tricyclo(,7)dec-1-yl- 5

pdb file: 733664.pdb
sdf file: 733664.sdf
directory: 733664

74141-68-7 Alanylbactobolin Bactobolin B L-Alaninamide, L-alanyl-N-(3-(dichloromethyl)-3,4,4a,5,6,7-hexahydro-5,6,8-trihydroxy-3-methyl-1-oxo-1H-2-benzopyran-4-yl)-, (3S-(3-alpha,4-alpha,4a-beta,5-beta,6-alpha))- Y 12896

pdb file: 733695.pdb
sdf file: 733695.sdf
directory: 733695

76338-79-9 D-Phenylalaninamide, L-tyrosyl-D-tryptophyl-L-alanyl-L-tryptophyl- 5

pdb file: 734101.pdb
sdf file: 734101.sdf
directory: 734101

(Nle(4)-dphe(7))alpha-melanocyte-stimulating hormone (Nle4,D-Phe7)-alpha-MSH 4-Nle-7-phe-alpha-msh 4-Norleucine-7-D-phenylalanine-alpha-melanocyte-stimulating hormone 4-Norleucyl-7-phenylalanine-alpha-msh 75921-69-6 MT-1 (Nlefmsh) Melanotan-1 Msh, 4-nle-7-phe-alpha- Msh, 4-norleucyl-7-phenylalanine-alpha- Ndp-msh alpha-Melanotropin, 4-L-norleucine-7-D-phenylalanine- alpha-Msh, nle(4)-phe(7)- alpha-Msh, norleucyl(4)-D-phenylalanyl(7)-

pdb file: 734256.pdb
sdf file: 734256.sdf
directory: 734256

76600-38-9 78149-02-7 81859-20-3 82111-44-2 Antibiotic 1907-VIII Antibiotic CC 1014 Antibiotic P-168 CC 1014 CC-1014 Leucinostatin A NSC 356885 P-168 Paecilotoxin A beta-Alaninamide, cis-4-methyl-1-(4-methyl-1-oxo-2-hexenyl)-L-prolyl-(4S,6S)-6-hydroxy-4-methyl-8-oxo-L-2-aminodecanoyl-threo-3-hydroxy-L-leucyl-2-methylalanyl-L-leucyl-L-leucyl-2-methylalanyl-2-methylalanyl-N-(2-(dimethylamino)-1-methylethyl)-, (1(S-(E)),9(S))-

pdb file: 734269.pdb
sdf file: 734269.sdf
directory: 734269

(Ac-delta(3)-Pro(1)-4-FD-phe(2)-D-trp(3,6))mgnrh 4F-Antag 78708-43-7 Ac-delta(2)-Pro(1)-4-F-phe(2)-trp(3,6)-LHRH Acetyl-1-dehydroprolyl-2-(4-fluorophenylalanyl)-3,6-tryptophan-LHRH Acetyl-delta(2)-prolyl(1)-4-fluoro-D-phenylalanyl(2)-tryptophyl(3,6)-GNRH Apfpt-LHRH GNRH, Ac-Dehydro-pro(1)-4-F-phe(2)-trp(3,6)- GNRH, Ac-delta(2)-Pro(1)-p-F-phe(2)-trp(3,6)- LHRH, ac-Dehydro-pro(1)-4-F-phe(2)-trp(3,6)- LHRH, ac-delta(2)-Pro(1)-4-F-phe(2)-trp(3,6)- LHRH, ac-delta(3)-Pro(1)-4-F-phe(2)-P-trp(3,6)- LHRH-Acetyl-1-dehydroprolyl-2-(4-fluorophenylalanyl)-3,6-tryptophan Luteinizing hormone-releasing factor, 1-(1-acetyl-3,4-didehydro-L-proline)-2-(4-fluoro-D-phenylalanine)-3-D-tryptophan-6-D-tryptophan-

pdb file: 734354.pdb
sdf file: 734354.sdf
directory: 734354

1-(2-Fluoropropionyl)-phe-octreotide 178181-50-5 L-Cysteinamide, N-(2-fluoro-1-oxopropyl)-D-phenylalanyl-L-cysteinyl-L-phenylalanyl-D-tryptophyl-L-lysyl-L-threonyl-N-(2-hydroxy-1-(hydroxymethyl)propyl)-, cyclic (2-7)-disulfide N-(2-Fluoro-1-oxopropyl)-D-phenylalanyl-L-cysteinyl-L-phenylalanyl-D-tryptophyl-L-lysyl-L-threonyl-N-(2-hydroxy-1-(hydroxymethyl)propyl)-L-cysteinamide cyclic (2-7)-disulfide Octreotide, 2-fluoropropionyl-phe(1)- Octreotide, 2-fluoropropionylphenylalanyl(1)- Sdz 223-228 Sdz 223228

pdb file: 734743.pdb
sdf file: 734743.sdf
directory: 734743

170809-51-5 Astressin Cyclo(30-33)(phe(12),nle(21,38),glu(30),lys(33))r-hcrf(12-41) L-Isoleucinamide, D-phenylalanyl-L-histidyl-L-leucyl-L-leucyl-L-arginyl-L-alpha-glutamyl-L-valyl-L-leucyl-L-alpha-glutamyl-L-norleucyl-L-alanyl-L-arginyl-L-alanyl-L-alpha-glutamyl-L-glutaminyl-L-leucyl-L-alanyl-L-glutaminyl-L-alpha-glutamyl-L-alanyl-L-histidyl-L-lysyl-L-asparaginyl-L-argin

pdb file: 734746.pdb
sdf file: 734746.sdf
directory: 734746

168482-23-3 Ac-Nle(4)-c(asp(5)-2'-nal(7)-lys(10))alpha-msh(4-10)-NH2 Acetyl-norisoleucyl(4)-cyclo(aspartyl(5)-2'-naphthylalanyl(7)-lysyl(10))alpha-msh(4-10)-amide L-Lysinamide, N-acetyl-L-norleucyl-L-alpha-aspartyl-L-histidyl-3-(2-naphthalenyl)-D-alanyl-L-arginyl-L-tryptophyl-, cyclic (2-7)-peptide N-Acetyl-L-norleucyl-L-alpha-aspartyl-L-histidyl-3-(2-naphthalenyl)-D-alanyl-L-arginyl-L-tryptophyl-L-lysinamide cyclic (2-7)-peptide Shu 9119 Shu-9119

pdb file: 734749.pdb
sdf file: 734749.sdf
directory: 734749

79385-97-0 beta-Alanine, 4-carboxy-2-hydroxypentanoyl-L-prolyl-L-valyl-N-methyl-L-valyl-N-methyl-L-alanyl-, (6-

pdb file: 734926.pdb
sdf file: 734926.sdf
directory: 734926

79385-98-1 beta-Alanine, 4-carboxy-2-hydroxypentanoyl-2-piperidinecarbonyl-L-isoleucyl-N-methyl-L-valyl-N-methyl-L-alanyl-, (6-

pdb file: 734927.pdb
sdf file: 734927.sdf
directory: 734927

79385-99-2 beta-Alanine, 2,5-dihydroxy-4-methylpentanoyl-L-prolyl-L-valyl-N-methyl-L-valyl-N-methyl-L-alanyl-, (6-

pdb file: 734928.pdb
sdf file: 734928.sdf
directory: 734928

80111-95-1 L-Valine, N-(3-hydroxy-1-oxononyl)glycyl-L-valyl-D-leucyl-L-alanyl-, (5-

pdb file: 735044.pdb
sdf file: 735044.sdf
directory: 735044

80111-96-2 L-Alanine, N-(3-hydroxy-1-oxononyl)glycyl-L-valyl-D-leucyl-L-alanyl-, (5-

pdb file: 735045.pdb
sdf file: 735045.sdf
directory: 735045

80111-97-3 L-Alanine, N-(3-hydroxy-1-oxoheptyl)glycyl-L-valyl-D-leucyl-L-alanyl-, (5-

pdb file: 735046.pdb
sdf file: 735046.sdf
directory: 735046

161876-61-5 Glycine, N-(N-(N-((acetylthio)acetyl)-4-isothiocyanato-L-phenylalanyl)glycyl), ethyl ester Maipgg N-(S-Acetylmercaptoacetyl)-4-isothiocyanate-phenylalanyl-glycyl-glycine ethyl ester

pdb file: 735115.pdb
sdf file: 735115.sdf
directory: 735115

244015-05-2 IB-367-03 Iseganan Hydrochloride Iseganan Hydrochloride [USAN] L-argininamide, L-arginylglycylglycyl-L-leucyl-L-cysteinyl-L-tyrosyl-L-cysteinyl-L-arginylglycyl-L-arginyl-L-phenylalanyl-L-cysteinyl-L-valyl-L-cysteinyl-L-valylglycyl-, cyclic (5?14), (7?12)-bis(disulfide), hydrochloride, hydrate

pdb file: 735222.pdb
sdf file: 735222.sdf
directory: 735222

(7-Methoxycoumarin-4-yl)acetyl-prolyl-lysyl-prolyl-glutaminyl-glutaminyl-phenylalanyl-phenylalanyl-glycyl-leucyl-(2,4-dinitrophenyl)lysyl-glycine 1-de-L-Arginine-2-(1-((7-methoxy-2-oxo-2H-1-benzopyran-4-yl)acetyl)-L-proline)-11-(N6-(2,4-dinitrophenyl)-L-lysine)-11a-glycinesubstance P 158584-07-7 Mca-pro-lys-pro-gln-gln-phe-phe-gly-leu-lys(dnp)-gly NFF 1 NFF-1 Substance P, 1-de-L-arginine-2-(1-((7-methoxy-2-oxo-2H-1-benzopyran-4-yl)acetyl)-L-proline)-11-(N6-(2,4-dinitrophenyl)-L-lysine)-11a-glycine-

pdb file: 735262.pdb
sdf file: 735262.sdf
directory: 735262

(7-Methoxycoumarin-4-yl)acetyl-arginyl-prolyl-lysyl-prolyl-tyrosyl-alanyl-norvalyl-tryptophyl-methionyl-(2,4-dinitrophenyl)lysinamide 158584-08-8 L-Lysinamide, N2-((7-methoxy-2-oxo-2H-1-benzopyran-4-yl)acetyl)-L-arginyl-L-prolyl-L-lysyl-L-prolyl-L-tyrosyl-L-alanyl-L-norvalyl-L-tryptophyl-L-methionyl-N6-(2,4-dinitrophenyl)- Mca-arg-pro-lys-pro-tyr-ala-nva-trp-met-lys(dnp)-NH2 N2-((7-Methoxy-2-oxo-2H-1-benzopyran-4-yl)acetyl)-L-arginyl-L-prolyl-L-lysyl-L-prolyl-L-tyrosyl-L-alanyl-L-norvalyl-L-tryptophyl-L-methionyl-N6-(2,4-dinitrophenyl)-L-lysinamide NFF 2 NFF-2

pdb file: 735264.pdb
sdf file: 735264.sdf
directory: 735264

81557-54-2 GNRH, N-Ac-ala(1)-(4-Cl-phe)(2)-trp(3,6)- LHRH, N-Acetylphenylalanyl(1)-(4-chlorophenylalanyl)(2)-tryptophan(3,6)- LHRH, N-ac-ala(1)-(4-Cl-phe)(2)-trp(3,6)- Luteinizing hormone-releasing factor, 1-(N-acetyl-L-alanine)-2-(4-chloro-D-phenylalanine)-3-D-tryptophan-6-D-tryptophan- N-Ac-1-Ala-2-(4-Cl-phe)-3,6-trp-LHRH Naapcpt-LHRH

pdb file: 735329.pdb
sdf file: 735329.sdf
directory: 735329

81500-68-7 L-Prolinamide, N-(chloroacetyl)-L-alanyl-L-phenylalanyl-

pdb file: 735390.pdb
sdf file: 735390.sdf
directory: 735390

81500-69-8 L-Prolinamide, N-(3-(chloroacetyl)benzoyl)-L-phenylalanyl-

pdb file: 735391.pdb
sdf file: 735391.sdf
directory: 735391

81500-70-1 L-Prolinamide, N-(4-(chloroacetyl)benzoyl)-L-phenylalanyl-

pdb file: 735392.pdb
sdf file: 735392.sdf
directory: 735392

151308-34-8 L-Tryptophan, glycyl-L-asparaginyl-L-tryptophyl-L-histidylglycyl-L-threonyl-L-alanyl-L-prolyl-L-alpha-aspartyl-L-tryptophyl-L-phenylalanyl-L-phenylalanyl-L-asparaginyl-L-tyrosyl-L-tyrosyl-, cyclic (9-1)-peptide Res 701-1 Res-701-1

pdb file: 735827.pdb
sdf file: 735827.sdf
directory: 735827

83398-08-7 Glycine, N-((1S)-1-carboxy-3-phenylpropyl)-L-alanyl-N-(2,3-dihydro-1H-inden-2-yl)-

pdb file: 735943.pdb
sdf file: 735943.sdf
directory: 735943

204992-09-6 4-Fluoro-L-phenylalanyl-trans-4-hydroxy-L-prolyl-L-arginylglycyl-L-tryptophanamide bis(trifluoroacetate) (salt) INN 00835 INN-00835 L-tryptophanamide, 4-fluoro-L-phenylalanyl-(4R)-4-hydroxy-L-prolyl-L-arginylglycyl-bis(trifluoroacetate) (salt) Nemifitide ditriflutate Nemifitide ditriflutate[USAN]

pdb file: 735978.pdb
sdf file: 735978.sdf
directory: 735978

151956-24-0 Desferrioxamine B-succinyl-phenylalanine(1)-octreotide Dfo-sms Gallium (67)-dfo-sms Gallium (68)-dfo-sms Gallium-68Ga, ((R-(R*,R*))-N-(11,22,33-trihydroxy-1,4,12,15,23,26,34-heptaoxo-5,11,16,22,27,33-hexaazapentatriacont-1-yl)-D-phenylalanyl-L-cysteinyl-L-phenylalanyl-D-tryptophyl-L-lysyl-L-threonyl-N-(2-hydroxy-1-(hydroxymethyl)propyl)-L-cysteinamide cyclic (2-7)-disulfidato(3-))- Sdz 216-927

pdb file: 735989.pdb
sdf file: 735989.sdf
directory: 735989

151957-35-6 Eey(P)AA Glu-glu-tyr(P)-ala-ala Glutamyl-glutamyl-phosphotyrosyl-alanyl-alanine L-Alanine, N-(N-(N-(N-L-alpha-glutamyl-L-alpha-glutamyl)-O-phosphono-L-tyrosyl)-L-alanyl)-

pdb file: 735990.pdb
sdf file: 735990.sdf
directory: 735990

151957-36-7 Fmoc-eey(P)AA Fmoc-glu-glu-tyr(P)-ala-ala L-Alanine, N-(N-(N-(N-(N-((9H-fluoren-9-ylmethoxy)carbonyl)-L-alpha-glutamyl)-L-alpha-glutamyl)-O-phosphono-L-tyrosyl)-L-alanyl)- N-(alpha)Fluorenylmethoxycarbonyl-glutamyl-glutamyl-phosphotyrosyl-alanyl-alanine

pdb file: 735991.pdb
sdf file: 735991.sdf
directory: 735991

204318-14-9 Edotreotide Edotreotide [USAN] L-Cysteinamide, N-((4,7,10-tris(carboxymetnyl)-1,4,7,10-tetraazacyclodec-1-yl)acetyl)-D-phenylalanyl-L-cysteinyl-L-tyrosyl-D-tryptophyl-L-lysyl-L-threonyl-N-((1R,2R)-2-hydroxy-1-(hydroxymethyl)propyl)-, cyclic(2-7)-disulfide N-((4,7,10-tris(carboxymethyl)-1,4,7,10-tetraazacycoldodec-1-yl)acetyl-D-phenylalanyl-L-cysteinyl-L-tyrosyl-D-tryprophyl-L-lysyl-L-threonyl-N-((1R,2R)-2-hydroxy-1-(hydroxymethyl)propyl)-L cysteinamide cyclic (2-7)-disulfide SMT 487 SMT-487

pdb file: 736224.pdb
sdf file: 736224.sdf
directory: 736224

(E)-5-(2-Bromovinyl)-2'-deoxy-5'-uridyl phenyl L-methoxyalaninylphosphoramidate 232925-18-7 5-(2-Bromovinyl)-2'-deoxy-5'-uridyl-phenyl-alanylphosphoramidate, trans- BVDU prodrug E-5-(2-bromovinyl)-2'-deoxyuridine-5'-(L-methylalaninyl)-phenylphosphoramidate L-Alanine, N-(5-((1E)-2-bromoethenyl)-2'-deoxy-P-phenyl-5'-uridylyl)-, methyl ester NB 1011

pdb file: 736236.pdb
sdf file: 736236.sdf
directory: 736236

87367-18-8 Glycine, N-(N-L-gamma-glutamyl-3-thiiranio-L-alanyl)-, bromide

pdb file: 736516.pdb
sdf file: 736516.sdf
directory: 736516

(S)-N-(4-((Aminoiminomethyl)amino)-1-cyanobutyl)-D-phenylalanyl-L-prolinamide 111009-86-0 D-Phenylalanyl-L-prolyl-L-arginine nitrile L-Prolinamide, D-phenylalanyl-N-(4-((aminoiminomethyl)amino)-1-cyanobutyl)-, (S)- L-Prolinamide, N-(4-((aminoiminomethyl)amino)-1-cyanobutyl)-D-phenylalanyl-, (S)- Phenylalanyl-prolyl-arginine nitrile

pdb file: 736783.pdb
sdf file: 736783.sdf
directory: 736783

128439-50-9 H-Ydpapppppp-OH Mosquito oostatic factor Oostatic factor, mosquito Oostatic hormone A (Aedes aegypti) Peptide oostatic hormone Peptide oostatic hormone (Diptera) TMOF TMOF, mosquito Trypsin modulating oostatic factor, mosquito Trypsin-modulating oostatic factor (Aedes aegypti) 10 Tyrosyl-aspartyl-prolyl-alanyl-prolyl-prolyl-prolyl-prolyl-prolyl-proline

pdb file: 736968.pdb
sdf file: 736968.sdf
directory: 736968

133155-90-5 Cyclo((S)-eta-oxo-L-alpha-aminooxiraneoctanoyl-L-phenylalanyl-L-phenylalanyl-D-2-piperidinecarbonyl) Cyclo((S)-phenylalanyl-phenylalanyl-(R)-prolyl-2-amino-8-oxo-9,10-epoxydecanoyl) Cyclo((alphaS,2S)-alpha-amino-eta-oxooxiraneoctanoyl-L-phenylalanyl-L-phenylalanyl-D-prolyl) 4 Trapoxin B

pdb file: 736976.pdb
sdf file: 736976.sdf
directory: 736976

(D-Pen(2)-pcl-phe(4)-D-pen(5))enkephalin (D-Pen2,5, pCl-Phe4)enkephalin 122507-47-5 2,5-Pen-4-(4-chloro-phe)-enkephalin 2,5-Penicillamine-4-(4-chlorophenylalanine)-enkephalin D-Valine, L-tyrosyl-3-mercapto-D-valylglycyl-4-chloro-L-phenylalanyl-3-mercapto-, cyclic (2-5)-disulfide Dpdp(Cl)E Enkephalin, D-pen(2), D-pen(5), p-Cl-phe(4) Enkephalin, pen(2,5)-4-chloro-phe(4)- Enkephalin, penicillamine(2,5)-4-chlorophenylalanine(4)- Pcl-dpdpe

pdb file: 737024.pdb
sdf file: 737024.sdf
directory: 737024

78493-58-0 D-Alaninamide, N-acetyl-4-chloro-D-phenylalanyl-4-chloro-D-phenylalanyl-D-tryptophyl-L-seryl-L-tyrosyl-D-phenylalanyl-L-leucyl-L-arginyl-L-prolyl- Des-Gly(sup 10)-GNRH D-alanylamide Gonadotropin-releasing hormone, des-gly(sup 10)-, D-alaninamide LHRH,(N)-Ac-(4-Cl-Phe)(1)-(4-Cl-phe)(2)-trp(3)-phe(6)-alanh2(10)- ORG 30093

pdb file: 737535.pdb
sdf file: 737535.sdf
directory: 737535

79645-16-2 L-Lysinamide, glycyl-6-carboxy-N(sup 6)-(N-(N-(1-oxododecyl)-L-alanyl)-D-gamma-glutamyl)-, threo- L-Lysinamide, glycyl-6-carboxy-N6-(N-(N-(1-oxododecyl)-L-alanyl)-D-gamma-glutamyl)-, threo- Pimelautide RP 44102

pdb file: 737538.pdb
sdf file: 737538.sdf
directory: 737538

85921-53-5 Altiopril calcium Calcium (-)-N-(((S)-3-(N-cyclohexylcarbonyl-D-alanyl)thio)-2-methylpropionyl)-L-prolinate L-Proline, 1-(3-((2-((cyclohexylcarbonyl)amino)-1-oxopropyl)thio)-2-methyl-1-oxopropyl)-, calcium salt (2:1), (R-(R*,S*))- Lowpres MC 838 MC-838 Moveltipril calcium Moveltipril calcium salt

pdb file: 737556.pdb
sdf file: 737556.sdf
directory: 737556

86402-37-1 Antibiotic FR 900261 Antibiotic WF 3161 Cyclic(eta-oxo-alpha-aminooxiraneoctanoylphenylalanylleucyl-2-piperidinecarbonyl) FR 900261 WF 3161 WF-3161

pdb file: 737561.pdb
sdf file: 737561.sdf
directory: 737561

1395-20-6 1395-22-8 1404-81-5 29393-20-2 7-Oxabicyclo(4.1.0)heptane-2-propionic acid, alpha-(2-aminopropionamido)-5-oxo-, stereoisomer Alanyl(2,3-epoxycyclohexanone-4)alanine Antibiotic KM 208 Bacillin Bacilysin KM-208 N-L-Alanyl-3-(5-oxo-7-oxabicyclo(4.1.0)hept-2-yl)-L-alanine Tetaine alpha-((2-Amino-1-oxopropyl)amino)-5-oxo-7-oxabicyclo(4.1.0)heptane-2-propanoic acid alpha-(2-Aminopropionamido)-5-oxo-7-oxabicyclo(4.1.0)heptane-2-propionic acid

pdb file: 737633.pdb
sdf file: 737633.sdf
directory: 737633

(1-Penicillamine,2-p-methyl-phenylalanine,4-threonine,8-ornithine)vasotocin 1-Pen-2-(mephe)-4-thr-8-orn-oxytocin 106128-84-1 Opmpto Oxytocin, 1-(3-mercapto-L-valine)-2-(4-methyl-L-phenylalanine)-4-L-threonine-8-L-ornithine- Oxytocin, pen(1)-(4-mephe)(2)-thr(4)-orn(8)- Oxytocin, penicillaminyl(1)-(4-methylphenylalanyl)(2)-threonyl(4)-ornithine(8)- P(Phe(Me)(2),thr(4))ovt

pdb file: 737818.pdb
sdf file: 737818.sdf
directory: 737818

118689-25-1 Hplp (3-34) L-Alanine, L-seryl-L-alpha-glutamyl-L-histidyl-L-glutaminyl-L-leucyl-L-leucyl-L-histidyl-L-alpha-aspartyl-L-lysylglycyl-L-lysyl-L-seryl-L-isoleucyl-L-glutaminyl-L-alpha-aspartyl-L-leucyl-L-arginyl-L-arginyl-L-arginyl-L-phenylalanyl-L-phenylalanyl-L-leucyl-L-histidyl-L-histidyl-L-leucyl-L-isoleucyl-L-alanyl-L-alpha-glutamyl-L-isoleucyl-L-histidyl-L-threonyl- Parathyroid hormone-related protein (1-34), synthetic human Parathyroid hormone-related protein(3-34) Parathyroid-hormone-like peptide (3-34) Pth-like protein (3-34) Pthrp (3-34)

pdb file: 737829.pdb
sdf file: 737829.sdf
directory: 737829

137295-60-4 Hevein L-Aspartic acid, L-alpha-glutamyl-L-glutaminyl-L-cysteinylglycyl-L-arginyl-L-glutaminyl-L-alanylglycylglycyl-L-lysyl-L-leucyl-L-cysteinyl-L-prolyl-L-asparaginyl-L-asparaginyl-L-leucyl-L-cysteinyl-L-cysteinyl-L-seryl-L-glutaminyl-L-tryptophylglycyl-L-tryptophyl-L-cysteinylglycyl-L-seryl-L-threonyl-L-alpha-aspartyl-L-seryl-L-prolyl-L-alpha-aspartyl-L-histidyl-L-asparaginyl-L-cysteinyl-L-glutaminyl-L-seryl-L-asparaginyl-L-cysteinyl-L-lysyl-

pdb file: 737834.pdb
sdf file: 737834.sdf
directory: 737834

154721-67-2 D-Leucinamide, N-(3-carboxy-1-oxopropyl)-L-valyl-D-leucyl-L-prolyl-L-phenylalanyl-L-phenylalanyl-L-valyl- Succinyl-val-dleu-pro-phe-phe-val-dleu-NH2 Succinyl-valyl-leucyl-prolyl-phenylalanyl-phenylalanyl-valyl-leucinamide Succinyl-vlpffvl-NH2

pdb file: 737888.pdb
sdf file: 737888.sdf
directory: 737888

4289-02-5 6813-99-6 Acth (6-9) His-phe-arg-trp- Histidyl-phenylalanyl-arginyl-tryptophan L-Tryptophan, N-(N2-(N-L-histidyl-L-phenylalanyl)-L-arginyl)-

pdb file: 738247.pdb
sdf file: 738247.sdf
directory: 738247

1116-21-8 16305-88-7 3773-08-8 Glycine, N-(N-L-gamma-glutamyl-L-alanyl)- Norophthalamic acid gamma-Glu-ala-gly gamma-Glutamyl-alanyl-glycine

pdb file: 738676.pdb
sdf file: 738676.sdf
directory: 738676

20750-72-5 BRN 3027998 Norphalloin Norphalloine cyclic(L-Alanyl-D-threonyl-L-cysteinyl-cis-4-hydroxy-L-prolyl-L-alanyl-2-mercapto-L-tryptophyl-L-norvalyl) cyclic (3-6)-sulfide

pdb file: 738832.pdb
sdf file: 738832.sdf
directory: 738832

10-(3-(Diethylamino)-1-oxopropyl)-2-(trifluoromethyl)-10H-phenothiazine monohydrochloride 10-Diethylaminopropionyl-3-trifluoromethyl phenothiazine hydrochloride 10H-Phenothiazine, 10-(3-(diethylamino)-1-oxopropyl)-2-(trifluoromethyl)-, monohydrochloride 27312-93-2 30223-48-4 BRN 1229602 Fluoracizine hydrochloride Fluoracyzine hydrochloride Phenothiazine, 10-(N,N-diethyl-beta-alanyl)-2-(trifluoromethyl)-, monohydrochloride (8CI) Phenothiazine, 10-diethylaminopropionyl-3-trifluoromethyl-, hydrochloride Phthoracizine

pdb file: 739075.pdb
sdf file: 739075.sdf
directory: 739075

29451-71-6 Pyro-glu-val-pro-gln-trp-ala-val-gly-his-phe-met-amide Pyroglutamyl-valyl-prolyl-glutaminyl-tryptophyl-alanyl-valyl-glycyl-histidyl-phenylalanyl-methionylamide Ranatensin

pdb file: 739155.pdb
sdf file: 739155.sdf
directory: 739155

34783-35-2 L-Prolinamide, 5-oxo-L-prolyl-L-phenylalanyl- Pglu-phe-pro-NH2 Pyroglutamyl-phenylalanyl-prolinamide Pyroglutamyl-phenylalanyl-proline amide

pdb file: 739366.pdb
sdf file: 739366.sdf
directory: 739366

38305-84-9 L-Phenylalanine, N-(3-(bis(2-chloroethyl)amino)-N-L-prolyl-L-phenylalanyl)-4-fluoro- L-Propyl-m-sarcolysyl-L-p-fluorophenylalanine N-(3-(Bis(2-chloroethyl)amino)-N-L-prolyl-L-phenylalanyl)-4-fluoro-L-phenylalanine Propyl-3-sarcolysin-4-fluorophenylalanine

pdb file: 739491.pdb
sdf file: 739491.sdf
directory: 739491

38232-20-1 L-Norvaline, N-(3-(bis(2-chloroethyl)amino)-N-L-prolyl-L-phenylalanyl)- MF 13 MF-13 MF13 Cpd Pro-3-bca-phe-nva ethyl ester Prolyl-m-(bis(chloroethyl)amino)phenylalanyl-norvaline ethyle ester hydrochloride

pdb file: 739824.pdb
sdf file: 739824.sdf
directory: 739824

51257-86-4 Bovine parathyroid hormone (3-34) Bpth (3-34) Hpth (3-34) L-Phenylalanine, L-seryl-L-alpha-glutamyl-L-isoleucyl-L-glutaminyl-L-phenylalanyl-L-methionyl-L-histidyl-L-asparaginyl-L-leucylglycyl-L-lysyl-L-histidyl-L-leucyl-L-seryl-L-seryl-L-methionyl-L-alpha-glutamyl-L-arginyl-L-valyl-L-alpha-glutamyl-L-tryptophyl-L-leucyl-L-arginyl-L-lysyl-L-lysyl-L-leucyl-L-glutaminyl-L-alpha-aspartyl-L-valyl-L-histidyl-L-asparaginyl- Parathyroid hormone (3-34)

pdb file: 740158.pdb
sdf file: 740158.sdf
directory: 740158

1-D-Phenylalanyl-L-proline 51926-52-4 D-Phe-pro L-Phe-pro L-Proline, 1-D-phenylalanyl- Phenylalanylproline

pdb file: 740180.pdb
sdf file: 740180.sdf
directory: 740180

54653-62-2 N(beta)-Alanyldopamine N-beta-Alanyldopamine Propanamide, 3-amino-N-(2-(3,4-dihydroxyphenyl)ethyl)-

pdb file: 740278.pdb
sdf file: 740278.sdf
directory: 740278

1,4,7,10-Tetraazacyclododecane-2,5,8,11-tetrone, 3-butyl-1,6,7-trimethyl-12-(phenylmethylene)-, (3S-(3R*,6R*,12E))- 54987-63-2 Cyclo(N-methyl-ala-leu-N-methyl-phe-gly) Cyclo(N-methyl-alanyl-leucyl-N-methyl-phenylalanyl-glycyl) Dihydrotentoxin

pdb file: 740286.pdb
sdf file: 740286.sdf
directory: 740286

56072-96-9 AM Toxin II L-Alanine, N-(2,3-didehydro-N-(N-(2-hydroxy-3-methyl-1-oxobutyl)-5-phenyl-L-norvalyl)alanyl)-, kappa-lactone, (S)-

pdb file: 740310.pdb
sdf file: 740310.sdf
directory: 740310

57765-94-3 AM Toxin III AM-Toxin III L-Alanine, N-(2,3-didehydro-N-(N-(2-hydroxy-3-methyl-1-oxobutyl)-5-(4-hydroxyphenyl)-L-norvalyl)alanyl)-, kappa-lactone, (S)-

pdb file: 740357.pdb
sdf file: 740357.sdf
directory: 740357

61925-94-8 85562-33-0 Alaninamide, N-(alpha-methylphenethyl)-3-phenyl-, L- Benzenepropanamide, alpha-amino-N-(1-methyl-2-phenylethyl)-, (R-(R*,S*))- L-N-(alpha-Methylphenethyl)-3-phenylalaninamide N-L-Phenylalanyl L-2-amino-1-phenylpropane N-L-Phenylalanyl-L-2-amino-1-phenylpropane

pdb file: 740468.pdb
sdf file: 740468.sdf
directory: 740468

62896-17-7 Antibiotic N-1409 BRN 2513264 D-Norvaline, N-(N(sup 2)-L-alanyl-L-asparginyl)-2,4-didehydro-5-phosphono-, (Z)- N-1409 Plumbemycin B Plumbemycin-B cis-N-(N(sup 2)-L-Alanyl-L-asparginyl)-3,4-didehydro-5-phosphono-D-norvaline

pdb file: 740496.pdb
sdf file: 740496.sdf
directory: 740496

62896-18-8 Antibiotic N-1409 A BRN 2490358 D-Norvaline, N-(N-L-alanyl-L-alpha-aspartyl)-3,4-didehydro-5-phosphono-, (Z)- N-1409 A Plumbemycin A cis-N-(N-L-Alanyl-L-alpha-aspartyl)-3,4-didehydro-5-phosphono-D-norvaline

pdb file: 740497.pdb
sdf file: 740497.sdf
directory: 740497

63596-81-6 Ala-arg-pro-pro-gly-phe-ser-pro-phe-arg-ile-val Phyllokinin, N2-L-alanyl-11-L-valine- Vespakinin-X

pdb file: 740522.pdb
sdf file: 740522.sdf
directory: 740522

1-Pyr-2-phe-3,6-trp-LHRH 68059-94-9 GNRH, pglu(1)-phe(2)-trp(3,6)- Gpt-LHRH LHRH, D-pglu(1)-D-phe(2)-D-trp(3,6)- LHRH, pglu(1)-phe(2)-trp(3,6)- LHRH, pyroglutamyl(1)-phenylalanyl(2)-tryptophyl(3,6)- Luteinizing hormone-releasing factor, 1-(5-oxo-D-proline)-2-D-phenylalanine-3-D-tryptophan-6-D-tryptophan-

pdb file: 740677.pdb
sdf file: 740677.sdf
directory: 740677

81608-50-6 Acetyl-1,2-(p-chlorophenylalanyl)-3-tryptophyl-5-tyrosyl-6-lysyl-10-alanine-gnrh Acpttl-gnrh D-Alaninamide, N-acetyl-4-chloro-D-phenylalanyl-4-chloro-D-phenylalanyl-D-tryptophyl-L-seryl-L-tyrosyl-D-lysyl-L-leucyl-L-arginyl-L-prolyl- GNRH, Ac(4-Cl-phe(1,2)-trp(3)-tyr(5)-lys(6)-ala(10))- LHRH, ac(4-Cl-Phe(1,2)-trp(3)-tyr(5)-lys(6)-ala(10))-

pdb file: 740839.pdb
sdf file: 740839.sdf
directory: 740839

82576-50-9 Alahopcin Antibiotic B 52653 Antibiotic T 804A B-52653 BRN 4818264 L-Norvaline, N-L-alanyl-3-((hydroxyamino)carbonyl)-5-oxo-, threo- Nourseimycin threo-N-L-Alanyl-3-((hydroxyamino)carbonyl)-5-oxo-L-norvaline

pdb file: 740847.pdb
sdf file: 740847.sdf
directory: 740847

4-Pro-7,9-trp-11-leunh2-substance P (4-11) 87026-40-2 L-Leucinamide, D-prolyl-L-glutaminyl-L-glutaminyl-D-tryptophyl-L-phenylalanyl-D-tryptophyl-L-leucyl- Pts-substance P (4-11) Substance P (4-11), pro(4)-trp(7,9)-leunh2(11)- Substance P (4-11),prolyl(4)-tryptophyl(7,9)-leucinamide(11)-

pdb file: 741001.pdb
sdf file: 741001.sdf
directory: 741001

118013-66-4 94102-64-4 D-Alanine, N-(N-acetyl-4-O-(2-(acetylamino)-2-deoxy-beta-D-glucopyranosyl)-1,6-anhydro-beta-muramoyl)-L-alanyl-D-gamma-glutamyl)-(6R)-6-carboxy-L-lysyl- Tat-BP Tracheal cytotoxin, bordetella pertussis

pdb file: 741092.pdb
sdf file: 741092.sdf
directory: 741092

1-(N)-Ac-3(2-Naphthyl)ala-2-(4-Cl-phe)-3-trp-6-arg-7-phe-10-alanh2-LHRH 1-Acetylnaphthyl-2-(4-chlorophenylalanyl)-3-tryptophyl-6-arginyl-7-phenylalanyl-10-alaninamide-LHRH 96394-82-0 D-Alaninamide, N-acetyl-3-(2-naphthalenyl)-D-alanyl-4-chloro-D-phenylalanyl-D-tryptophyl-L-seryl-L-tyrosyl-D-arginyl-L-phenylalanyl-L-arginyl-L-prolyl- GNRH, (N)-Ac-3(2-naphthyl)ala(1)-(4-Cl-phe)(2)-trp(3)-arg(6)-phe(7)-alanh2(10)- LHRH, (N)-Ac-3(2-Naphthyl)ala(1)-(4-Cl-phe)(2)-trp(3)-arg(6)-phe(7)-alanh2(10)- LHRH, (N)-Acetyl-3(2-naphthyl)alanyl(1)-4-chlorophenylalanyl(2)-tryptophyl(3)-arginyl(6)-phenylalanyl(7)-alaninamide(10)- LHRH-Nptapa

pdb file: 741119.pdb
sdf file: 741119.sdf
directory: 741119

(Asn-ala-asn-pro)3 (Asparaginyl-alanyl-asparaginyl-proline)3 (Nanp)3 97557-30-7 L-Proline, 1-(N2-(N-(N2-(1-(N2-(N-(N2-(1-(N2-(N-L-asparaginyl-L-alanyl)-L-asparaginyl)-L-prolyl)-L-asparaginyl)-L-alanyl)-L-asparaginyl)-L-prolyl)-L-asparaginyl)-L-alanyl)-L-asparaginyl)-

pdb file: 741123.pdb
sdf file: 741123.sdf
directory: 741123

(Thi(5,8),D-phe(7))bradykinin 5,8-(Thi-ala)-7-phe-bradykinin 97825-07-5 Bradykinin, (thi-ala)(5,8)-phe(7)- Bradykinin, 5-(3-(2-thienyl)-L-alanine)-7-D-phenylalanine-8-(3-(2-thienyl)-L-alanine)- Bradykinin, thienylalanyl(5,8)-phenylalanine(7)- Npc 431 TA5,8-F7-BK

pdb file: 741126.pdb
sdf file: 741126.sdf
directory: 741126

98105-34-1 ACRIP Achpa-renin inhibitory peptide Iva-his-pro-phe-his-achpa-leu-phenh2 L-phenylalaninamide, N-(5-cyclohexyl-3-hydroxy-4-((N-(N-(1-(N-(3-methyl-1-oxobutyl)-L-histidyl)-L-prolyl)-L-phenylalanyl)-L-histidyl)amino)-1-oxopentyl)-L-leucyl-, (S-(R*,R*))- Nalpha-isovaleryl-histidyl-prolyl-phenylalanyl-histidyl-achpa-leucyl-phenylalaninamide Renin inhibitory peptide, 4-amino-5-cyclohexyl-3-hydroxypentanoic acid

pdb file: 741129.pdb
sdf file: 741129.sdf
directory: 741129

99291-20-0 L-Methionine, N-(1-(N-(N-(N-(N-(N-(1-L-valyl-L-prolyl)-L-valyl)-L-alpha-glutamyl)-L-alanyl)-L-valyl)-L-alpha-aspartyl)-L-prolyl)- V-9-M V-9-M Cholecystokinin nonapeptide Val-pro-val-glu-ala-val-asp-pro-met Valyl-prolyl-valyl-glutamyl-alanyl-valyl-aspartyl-prolyl-methionine

pdb file: 741154.pdb
sdf file: 741154.sdf
directory: 741154

103631-79-4 6-Phe-8-gln-9-N-Et-pronh2-10-des-glynh2-LHRH Folligen GNRH, phe(6)-gln(8)-N-Et-pronh2(9)-des-glynh2(10)- GNRH-ethylamide, D-phe(6)-gln(8)-desgly(10)- LHRH, Phenylalanyl(6)-glutaminyl(8)-N-ethylprolinamide(9)-des-glycinamide(10)- LHRH, phe(6)-gln(8)-N-Et-pronh2(9)-des-glynh2(10)- Luteinizing hormone-releasing factor (pig), 6-D-phenylalanine-8-L-glutamine-9-(N-ethyl-L-prolinamide)-10-deglycinamide-

pdb file: 741187.pdb
sdf file: 741187.sdf
directory: 741187

103733-02-4 Ac-D-Nal(sup 1),D-4-Cl-Phe(sup 2),D-Pal(sup 3),Arg(sup 5),D-Glu(AA)(sup 6),D-Ala(sup 10) D-Alaninamide, N-acetyl-3-(2-naphthalenyl)-D-alanyl-4-chloro-D-phenylalanyl-3-(3-pyridinyl)-D-alanyl-L-seryl-L-arginyl-5-(4-methoxyphenyl)-5-oxo-D-norvalyl-L-leucyl-L-arginyl-L-prolyl- Na1-G1u Na1-glu ORF 21243

pdb file: 741188.pdb
sdf file: 741188.sdf
directory: 741188

10-Nle-neurokinin A (4-10) 110863-33-7 L-Norleucinamide-L-alpha-aspartyl-L-seryl-L-phenylalanyl-L-valylglycyl-L-leucyl- Neurokinin A (4-10), nle(10)- Neurokinin A (4-10), norleucine(10)- Nle(10)-nka(4-10)

pdb file: 741288.pdb
sdf file: 741288.sdf
directory: 741288

111846-43-6 2-Ala-4-(5-F-phe)-dynorphin amide (1-13) Dafphedyn Dynorphin A (pig), 2-D-alanine-4-(2,3,4,5,6-pentafluoro-L-phenylalanine)-13-L-lysinamide-14-de-L-tryptophan-15-de-L-aspartic acid-16-de-L-asparagine-17-de-L-glutamine- Dynorphin amide (1-13), ala(2)-(5-F-phe)(4)- Dynorphin amide (1-13), ala(2)-(F(5)-phe)(4)- Dynorphin amide (1-13), alanyl(2)-(5-fluorophenylalanine)(4)-

pdb file: 741327.pdb
sdf file: 741327.sdf
directory: 741327

113400-63-8 Azidobenzamido 008 Azidobenzamido-008 Cyclo(N6-(4-azidobenzoyl)-L-lysyl-L-tryptophyl-L-phenylalanyl-D-prolyl-4-(acetylamino)-L-phenylalanyl-L-threonyl) Cyclo(phe(4-NH)Ac)-thr-lys-(CO(4-N3)C6H4)-trp-phe-pro Cyclo(phenylalanyl-(4-acetylamino)threonyl-lysyl-(4-azidobenzoyl)tryptophyl-phenylalanyl-prolyl) Cyclo-ptltpp

pdb file: 741363.pdb
sdf file: 741363.sdf
directory: 741363

114037-60-4 L-threo-Pentonamide, 5-cyclohexyl-2,4,5-trideoxy-N-(1-(((2-hydroxy-1-(hydroxymethyl)-1-methylethyl)amino)carbonyl)-2-methylbutyl)-4-((N-(N-(1-oxo-3-(3-pyridinyl)propyl)-L-phenylalanyl)-L-histidyl)amino)-, (S-(R*,R*))- SR 43845 SR-43845

pdb file: 741373.pdb
sdf file: 741373.sdf
directory: 741373

114797-04-5 Butanamide, N-(((1-carboxy-2-(3-hydroxyphenyl)ethyl)amino)carbonyl)methionyl-N-((5-(3,4-dihydro-2,4-dioxo-1(2H)-pyrimidinyl)dihydro-4-hydroxy-2(3H)-furanylidene)methyl)-N(sup 3)-(3-hydroxyphenylalanyl)-N(sup 3)-methyl-D-2,3-diamino- MRD A Mureidomycin A

pdb file: 741393.pdb
sdf file: 741393.sdf
directory: 741393

114797-06-7 Butanamide, N-(((1-carboxy-2-(3-hydroxyphenyl)ethyl)amino)carbonyl)methionyl-N-((5-(3,4-dihydro-2,4-dioxo-1(2H)-pyrimidinyl)dihydro-4-hydroxy-2(3H)-furanylidene)methyl)-N(sup 3)-(N-glycyl-3-hydroxyphenylalanyl)-N(sup 3)-methyl-D-2,3-diamino- MRD C Mureidomycin C

pdb file: 741394.pdb
sdf file: 741394.sdf
directory: 741394

115136-18-0 Chromogranin A-derived peptide, WE-14 Chromogranin A-derived peptide, human Chromogranin A-derived tetradecapeptide, WE-14 L-Glutamic acid, L-tryptophyl-L-seryl-L-lysyl-L-methionyl-L-alpha-aspartyl-L-glutaminyl-L-leucyl-L-alanyl-L-lysyl-L-alpha-glutamyl-L-leucyl-L-threonyl-L-alanyl- WE-14, Human

pdb file: 741414.pdb
sdf file: 741414.sdf
directory: 741414

115150-59-9 Antagonist G Arg-trp-N-methyl-phe-trp-leu-met-NH2 Arginyl-tryptophyl-N-methylphenylalanyl-tryptophyl-leucyl-methioninamide H-Arg-D-trp-N(Me)phe-D-trp-leu-met-NH2 L-Arginyl-O-tryptophyl-N-methyl-L-phenylalanyl-D-tryptophyl-L-leucyl-L-methioninamide L-Methioninamide, L-arginyl-O-tryptophyl-N-methyl-L-phenylalanyl-D-tryptophyl-L-leucyl- RW-N(Me)F-Wlm-NH2

pdb file: 741415.pdb
sdf file: 741415.sdf
directory: 741415

115288-29-4 A-Gliadin peptide (206-217) Gliadin peptide A (206-217) L-Asparagine, N2-(N2-(N2-(N-(1-(N2-(N-(N-(N-(N2-(N-L-leucylglycyl)-L-glutaminyl)glycyl)-L-seryl)-phenylalanyl)-L-arginyl)-L-prolyl)-L-seryl)-L-glutaminyl)-L-glutaminyl)-

pdb file: 741417.pdb
sdf file: 741417.sdf
directory: 741417

115803-96-8 6-Phe-9-N-Et-pronh2-10-des-gly-LHRH GNRH, phe(6)-N-Et-pronh2- LHRH, phe(6)-N-Et-pronh2- LHRH, phenylalanyl(6)-N-ethylprolinamide(9)- Ovurelin

pdb file: 741432.pdb
sdf file: 741432.sdf
directory: 741432

117176-50-8 Benzyloxycarbonyltyrosylalanine diazomethane Benzyloxycarbonyltyrosylalanyldiazomethane Carbamic acid, (2-((3-diazo-1-methyl-2-oxopropyl)amino)-1-((4-hydroxyphenyl)methyl)-2-oxoethyl)-, phenylmethyl ester N-Benzyloxycarbonyl-tyrosyl-alanyl diazomethane N-Benzyloxycarbonyltyrosylalanyldiazomethane Z-Tyr-ala-chn2

pdb file: 741473.pdb
sdf file: 741473.sdf
directory: 741473

117858-54-5 Glycine, N-(N-(S-(2,3-bis((1-oxohexadecyl)oxy)propyl)-N-(1-oxohexadecyl)-L-cysteinyl)-L-alanyl)- N-Palmitoyl-5,6-dipalmitoylcysteinyl-alanyl-glycine Pam(3)-cys-ala-gly Pam3Cys-ala-gly S-(2,3-Bis(palmitoyloxy)propyl)-N-palmitoylcysteinyl-alanyl-glycine Tripalmitoyl-cysteinyl-alanyl-glycine

pdb file: 741498.pdb
sdf file: 741498.sdf
directory: 741498

118675-77-7 L-Arginine, N2-(N2-(N2-(N-(N-(N2-(N-(N2-(N-(N2-L-lysyl-L-arginyl)-L-alanyl)-L-lysyl)-L-alanyl)-L-lysyl)-L-threonyl)-L-threonyl)-L-lysyl)-L-lysyl)- Lys-arg-ala-lys-ala-lys-thr-thr-lys-lys-arg Lysyl-arginyl-alanyl-lysyl-alanyl-lysyl-threonyl-threonyl-lysyl-lysyl-arginine N2-(N2-(N2-(N-(N-(N2-(N-(N2-(N-(N2-L-Lysyl-L-arginyl)-L-alanyl)-L-lysyl)-L-alanyl)-L-lysyl)-L-threonyl)-L-threonyl)-L-lysyl)-L-lysyl)-L-arginine PKCS

pdb file: 741517.pdb
sdf file: 741517.sdf
directory: 741517

119425-35-3 A2-Binding peptide L-Valine, N-(N-(N-(N-(N-(N-(N2-(N-(N-(N-(N-L-lyslglycyl)-L-isoleucyl)-L-leucyl)glycyl)-L-lysyl)-L-valyl)-L-phenylalanyl)-L-threonyl)-L-leucyl)-L-threonyl)-

pdb file: 741550.pdb
sdf file: 741550.sdf
directory: 741550

124695-91-6 L-Methionyl-L-threonyl-L-alpha-aspartyl-L-valyl-L-alpha-glutamyl-L-threonyl-L-threonyl-L-tyrosyl-L-alanyl-L-alpha-aspartyl-L-phenylalanyl-L-isoleucyl-L-alanyl-L-serylglycyl-L-arginyl-L-threonylglycyl-L-arginyl-L-arginyl-L-asparaginyl-L-alanyl-L-isoleucyl-L-histidyl-L-alpha-aspartyl-L-isoleucyl-L-leucyl-L-valyl-L-seryl-L-seryl-L-alanyl-L-serine L-Serine, L-methionyl-L-threonyl-L-alpha-aspartyl-L-valyl-L-alpha-glutamyl-L-threonyl-L-threonyl-L-tyrosyl-L-alanyl-L-alpha-aspartyl-L-phenylalanyl-L-isoleucyl-L-alanyl-L-serylglycyl-L-arginyl-L-threonylglycyl-L-arginyl-L-arginyl-L-asparaginyl-L-alanyl-L-isoleucyl-L-histidyl-L-alpha-aspartyl-L-isoleucyl-L-leucyl-L-valyl-L-seryl-L-seryl-L-alanyl- Pki(1-31) Protein kinase inhibitor peptide (1-31)

pdb file: 741637.pdb
sdf file: 741637.sdf
directory: 741637

125774-71-2 L-Serine, N-(N(sup 2)-(N-(N-(N-((E)-alpha,beta-didehydro-N-methyl-N-(N-(1-oxo-3-(2-(1-pentenyl)phenyl)-2-propenyl)-L-threonyl)tyrosyl)-L-leucyl-D-phenylalanyl)-L-allothreonyl)-L-asparaginyl)-, upsilon-lactone, (E,Z)- L-Serine, N-(N2-(N-(N-(N-((E)-alpha,beta-didehydro-N-methyl-N-(N-(1-oxo-3-(2-(1-pentenyl)phenyl)-2-propenyl)-L-threonyl)tyrosyl)-L-leucyl)-D-phenylalanyl)-L-allothreonyl)-L-asparaginyl)-, upsilon-lactone, (E,Z)- WS 9326A

pdb file: 741649.pdb
sdf file: 741649.sdf
directory: 741649

125989-12-0 Cyclo(L-glutaminyl-L-tryptophyl-L-phenylalanylglycl-L-leucyl-L-methionyl) Cyclo(gln-trp-phe-gly-leu-met) L 659,877 L 659877 L-659,877 L-659877

pdb file: 741654.pdb
sdf file: 741654.sdf
directory: 741654

(1R-(1R*,2R*,4R*(1R*,2R*)))-1-(((2-Hydroxy-1,1-bis(hydroxymethyl)ethyl)amino)carbonyl)-L-prolyl-L-phenylalanyl-N-(2-hydroxy-5-methyl-1-(2-methylpropyl)-4-(((2-methyl-1-(((2-pyridinylmethyl)amino)carbonyl)butyl)amino)carbonyl)hexyl)-Nalpha-methyl-L-histidinamide N-oxide 128657-36-3 L-Histidinamide, 1-(((2-hydroxy-1,1-bis(hydroxymethyl)ethyl)amino)carbonyl)-L-prolyl-L-phenylalanyl-N-(2-hydroxy-5-methyl-1-(2-methylpropyl)-4-(((2-methyl-1-(((2-pyridinylmethyl)amino)carbonyl)butyl)amino)carbonyl)hexyl)-Nalpha-methyl-, N-oxide, (1R-(1R*,2R*,4R*(1R*,2R*)))- U 77436 U-77436

pdb file: 741698.pdb
sdf file: 741698.sdf
directory: 741698

129521-72-8 D-Glutamic acid, N-(N-(N-(N-(N-(1-(N-(1-(N-(N-(3-carboxy-1-oxopropyl)-L-tyrosyl)-L-alpha-glutamyl)-L-propyl)-L-isoleucyl)-L-prolyl)-L-alpha-glutamyl)-L-alpha-glutamyl)-L-alanyl)-3-cyclohexyl-L-alanyl)- Mdl 28050 Mdl-28050 Suc-tyr-glu-pro-ile-pro-glu-glu-ala-cha-glu-OH Succinyl-tyrosyl-glutamyl-prolyl-isoleucyl-prolyl-glutamyl-glutamyl-alanyl-beta-cyclohexylalanyl-glutamine

pdb file: 741712.pdb
sdf file: 741712.sdf
directory: 741712

129678-94-0 Cyanoginosin LA, 1-(N-methyl-DL-alanine)-5-L-arginine- Cyclo(ala-leu-beta-methyl-asp-arg-adda-glu-N-methyldehydro-ala) Cyclo(alanyl-leucyl-beta-methyl-aspartyl-arginyl-(3-amino-9-methoxy-2,6,8-trimethyl-10-phenyldeca-4,6-dienoic acid)-glutamyl-N-methyldehydroalanyl) Dihydromicrocystin LR Dihydromicrocystin-LR

pdb file: 741716.pdb
sdf file: 741716.sdf
directory: 741716

129809-09-2 Acetylleucyl-aspartyl-glutaminyl-tryptophyl-phenylalanyl-glycine amide Acleu-asp-gln-trp-phe-glynh2 Glycinamide, N-acetyl-L-leucyl-L-alpha-aspartyl-L-glutaminyl-L-tryptophyl-L-phenylalanyl- R 396 R396

pdb file: 741724.pdb
sdf file: 741724.sdf
directory: 741724

130092-56-7 AF1 Neuropeptide Fmrfamidelike peptide AF1 Knefirf-NH2 Knefirfamide L-Lysyl-L-asparaginyl-L-alpha-glutamyl-L-phenylalanyl-L-isoleucyl-L-arginyl-L-phenylalaninamide L-Phenylalaninamide, L-lysyl-L-asparaginyl-L-alpha-glutamyl-L-phenylalanyl-L-isoleucyl-L-arginyl- Lys-asn-glu-phe-ile-arg-phe-NH2

pdb file: 741727.pdb
sdf file: 741727.sdf
directory: 741727

130114-83-9 Dtp-gdp L-Alanine, N-(N2-(N-(N-acetyl-4-O-(2-(acetylamino)-2-deoxy-beta-D-glucopyranosyl)muramoyl)-L-alanyl)-D-alpha-glutaminyl)-, 2,3-bis((1-oxohexadecyl)oxy)propyl ester, (R)- N-Acetylglucosamine-N-acetylmuramyl-alanyl-isoglutaminyl-alanyl-glycerol dipalmitoyl

pdb file: 741728.pdb
sdf file: 741728.sdf
directory: 741728

130409-05-1 8-(4-Benzoyl-L-phenylalanine)substance P 8-(p-Benzoyl-L-phenylalanine)-substance P 8-BPA-substance P Bpa(8)-SP Substance P, 8-(4-benzoyl-L-phenylalanine)- Substance P, BPA(8)- Substance P, benzoylphenylalanyl(8)-

pdb file: 741739.pdb
sdf file: 741739.sdf
directory: 741739

132116-39-3 L-Asparagine, L-threonyl-L-methionyl-L-arginyl-L-lysyl-L-polyl-L-arginyl-L-cysteinylglycyl-L-asparaginyl-L-prolyl-L-alpha-aspartyl-L-valyl-L-alanyl- Peptide 74 Thr-met-arg-lys-pro-arg-cys-gly-asn-pro-asp-val-ala-asn Threonyl-methionyl-arginyl-lysyl-prolyl-arginyl-cysteinyl-glycyl-asparaginyl-prolyl-aspartyl-valyl-alanyl-asparagine

pdb file: 741759.pdb
sdf file: 741759.sdf
directory: 741759

(Arg(6)-cha(8))anp-(6-15)-D-tic-arg-cys-NH2 (Arginyl(6)-cyclohexylalanyl(8))anp-(6-15)-D-1,2,3,4-tetrahydro-3-isoquinolinecarbonyl-arginyl-cysteinamide 132956-87-7 A 71915 A-71915 A71915 L-Cysteinamide, L-arginyl-L-cysteinyl-3-cyclohexyl-L-alanylglycylglycyl-L-arginyl-L-isoleucyl-L-alpha-aspartyl-L-arginyl-L-isoleucyl-D-1,2,3,4-tetrahydro-3-isoquinolinecarbonyl-L-arginyl-, cyclic (2-13)-disulfide

pdb file: 741769.pdb
sdf file: 741769.sdf
directory: 741769

133928-36-6 Emd 51 921 Emd 51921 L-threo-Pentonamide, N-(1-((((4-amino-2-methyl-5-pyrimidinyl)methyl)amino)carbonyl)-2-methylbutyl)-5-cyclohexyl-2,4,5-trideoxy-4-((N-(N-((1,1-dimethylethoxy)carbonyl)-L-phenyl-2,6-t2-alanyl)glycyl)amino)-, (S-(R*,R*))-

pdb file: 741789.pdb
sdf file: 741789.sdf
directory: 741789

1-N-Ac-(4-Cl-Phe)-2-(4-Cl-phe)-3-(3-benzo(b)thi-ala)-6-lys-10-alanh2-LHRH 136208-71-4 D-Alaninamide, N-acetyl-4-chloro-D-phenylalanyl-4-chloro-D-phenylalanyl-3-benzo(b)thien-3-yl-D-alanyl-L-seryl-L-tyrosyl-D-lysyl-L-leucyl-L-arginyl-L-prolyl- GNRH, N-Ac-4-Cl-phe(1)-(4-Cl-phe)(2)-(3-benzo(b)thi-ala)(3)-lys(6)-alanh2(10)- LHRH, (N-Acetyl-4-chlorophenylalanyl)(1)-(4-chlorophenylalanyl)(2)-(3-benzo(b)thien-3-ylalanyl)(3)-lysyl(6)-alaninamide(10)- LHRH, N-Ac-(4-Cl-Phe)(1)-(4-clphe)(2)-(3-benzo(b)thi-ala)(3)-lys(6)-alanh2(10)- Org 30850 Org 30850 ant Org-30850

pdb file: 741827.pdb
sdf file: 741827.sdf
directory: 741827

137181-56-7 L-Alanyl-L-valyl-L-glutaminyl-L-seryl-L-lysyl-L-prolyl-L-prolyl-L-seryl-L-lysyl-L-arginyl-L-alpha-aspartyl-L-prolyl-L-prolyl-L-lysyl-L-methionyl-L-glutaminyl-L-threonyl-L-aspartic acid L-Aspartic acid, L-alanyl-L-valyl-L-glutaminyl-L-seryl-L-lysyl-L-prolyl-L-prolyl-L-seryl-L-lysyl-L-arginyl-L-alpha-aspartyl-L-prolyl-L-prolyl-L-lysyl-L-methionyl-L-glutaminyl-L-threonyl- Systemin

pdb file: 741832.pdb
sdf file: 741832.sdf
directory: 741832

137339-65-2 L-Phenylalanine, L-seryl-L-phenylalanyl-L-leucyl-L-leucyl-L-arginyl-L-asparaginyl-L-prolyl-L-asparaginyl-L-alpha-aspartyl-L-lysyl-L-tyrosyl-L-alpha-glutamyl-L-prolyl- Res (42-55) SFLL SFLLRNPNDKYEPF Ser-phe-leu-leu-arg-asn-pro-asn-asp-lys-tyr-glu-pro-phe Thrombin receptor agonist peptide (42-55) Thrombin receptor peptide (42-55) Thrombin receptor-derived polypeptide (42-55) Trap-14 peptide Trp (42-55)

pdb file: 741833.pdb
sdf file: 741833.sdf
directory: 741833

137348-10-8 L-Arginine, L-threonyl-L-arginyl-L-seryl-L-alanyl-L-tryptophyl-L-leucyl-L-alpha-aspartyl-L-serylglycyl-L-valyl-L-threonylglycyl-L-serylglycyl-L-leucyl-L-alpha-glutamylglycyl-L-alpha-aspartyl-L-histidyl-L-leucyl-L-seryl-L-alpha-aspartyl-L-thronyl-L-seryl-L-threonyl-L-threonyl-L-seryl-L-leucyl-L-alpha-glutamyl-L-leucyl-L-alpha-aspartyl-L-seryl- Parathyroid hormone-related protein-(107-139) Pthrp (107-139)

pdb file: 741834.pdb
sdf file: 741834.sdf
directory: 741834

138199-64-1 Cyclo(Ac-cys-asn-dmt-amf-gly-asp-cys) L 367073 L-367,073 L-Cysteine, N-acetyl-L-cysteinyl-L-asparaginyl-5,5-dimethyl-L-4-thiazolidinecarbonyl-4-(aminomethyl)-L-phenylalanylglycyl-L-alpha-aspartyl-, cyclic (1-7)-disulfide MK 0852 MK 852 MK-0852

pdb file: 741845.pdb
sdf file: 741845.sdf
directory: 741845

140909-80-4 L-Isoleucine, N-(N-(N-(N-(N-(3-hydroxy-1-oxodecyl)-D-leucyl)-L-seryl)-L-threonyl)-D-phenylalanyl)-, rho-lactone Serrawettin W2

pdb file: 741872.pdb
sdf file: 741872.sdf
directory: 741872

141039-76-1 L-Asporagine, L-lysylglycyl-L-alpha-aspartyl-L-tyrosyl-L-alpha-glutamyl-L-lysyl-L-isoleucyl-L-leucyl-L-valyl-L-alanyl-L-leucyl-L-cysteinylglycyglycyl- L-Lysylglycyl-L-alpha-aspartyl-L-tyrosyl-L-alpha-glutamyl-L-lysyl-L-isoleucyl-L-leucyl-L-valyl-L-alanyl-L-leucyl-L-cysteinylglycyglycyl-L-asporagine Peptide I RACK1

pdb file: 741874.pdb
sdf file: 741874.sdf
directory: 741874

((Des-NH2)phe(19)-D-ala(24)-D-pro(26)psi(CH2NH)phe(27))-grp(19-27) (de-NH2)Phe(19)-ala(24)-pro(26)psi(CH2NH)-phe(27)-grp (19-27) 142061-53-8 2258U89 BW 10 BW 2258U89 BW-10 D-Alaninamide, N-(1-oxo-3-phenylpropyl)-L-histidyl-L-tryptophl-L-alanyl-L-valyl-N-(2-(2-(((2-amino-2-oxo-1-(phenylmethyl)ethyl)amino)methyl)-1-pyrrolidinyl)-1-(1H-imidazol-4-ylmethyl)-2-oxoethyl)-, (2R-(1(S*),2R*(S*)))- Grp (19-27), (de-NH2)phe(19)-ala(24)-pro(26)psi(CH2NH)phe(27)- Grp (19-27),(de-NH2)phenylalanyl(19)-alanyl(24)-prolyl(26)psi(CH2NH)-phenylalanine(27)-

pdb file: 741879.pdb
sdf file: 741879.sdf
directory: 741879

142846-71-7 Galanin-(1-13)-bradykinin-(2-9)-amide L-Argininamide, glycyl-L-tryptophyl-L-threonyl-L-leucyl-L-asparaginyl-L-seryl-L-alanylglycyl-L-tyrosyl-L-leucyl-L-leucylglycyl-L-prolyl-L-prolylglycyl-L-phenylalanyl-L-seryl-L-prolyl-L-phenylalanyl- M 35 M-35 M35 Peptide

pdb file: 741887.pdb
sdf file: 741887.sdf
directory: 741887

143199-54-6 4-Nitrobenzo-2-oxa-1,3-diazol-beta-ala-phe-5-oxapro-gly-t-butylester Glycine, N-(7-nitro-4-benzofurazanyl)-beta-alanyl-L-phenylalanyl-L-3-isoxazolidinecarbonyl-, 1,1-dimethylethyl ester Nbd-beta-ala-phe-opr-gly-otbu S 4404 S-4404

pdb file: 741890.pdb
sdf file: 741890.sdf
directory: 741890

(S)-N-(2,2-Dimethyl-1-oxopropyl)-L-cystein ethyl ester, 2-(acetylamino)propanoate (ester) 144965-09-3 L-Cystein, N-(2,2-dimethyl-1-oxopropyl)-, ethyl ester, 2-(acetylamino)propanoate (ester), (S)- Pivaloyl-S-(N'-acetylalanyl)-cysteine ethyl ester Spm 5267 Spm-5267

pdb file: 741896.pdb
sdf file: 741896.sdf
directory: 741896

147159-51-1 L-Threoninamide, D-phenylalanyl-L-cysteinyl-L-tyrosyl-D-tryptophyl-L-lysyl-L-cysteinyl-, cyclic (2-6)-disulfide Phe-cys-tyr-trp-lys-cys-thr-NH2 (2-6)-disulfide Phenylalanyl-cysteinyl-tyrosyl-tryptophyl-lysyl-cysteinyl-threoninamide (2-6)-disulfide TT 232 TT-232

pdb file: 741905.pdb
sdf file: 741905.sdf
directory: 741905

147651-80-7 L-Arginine, L-methionyl-L-threonyl-L-threonyl-L-lysyl-L-lysyl-L-seryl-L-alanyl-L-alpha-glutamyl-L-valyl-L-leucyl-L-valyl-L-tyrosyl-L-prolyl-L-isoleucyl-L-phenylalanyl-L-threonyl-L-valyl-L-arginyl-L-tryptophyl-L-leucyl-L-alanyl-L-threonyl-L-threonyl-L-valyl-L-leucyl-L-glutaminyl-L-tyrosyl-L-glutaminyl-L-glutaminyl-L-phenylalanyl-L-phenylalanyl-L-phenylalanyl-L-leucylglycyl-L-alanyl-L-isoleucyl-L-threonyl-L-alanyl-L-methionyl-L-glutaminyl-L-phenylalanyl-L-isoleucyl-L-glutaminyl- Psbf gene product Psbf protein

pdb file: 741908.pdb
sdf file: 741908.sdf
directory: 741908

150747-52-7 Ass 51 Ass-51 L-Cysteinamide, N- ((1-mercaptocyclohexyl)acetyl)-L-phenylalanyl-D-tryptophyl-L-lysyl-L-threonyl-N-(2-hydroxy-1-(hydroxymethyl)-1-methylethyl)-, cyclic (1-5)-disulfide

pdb file: 741929.pdb
sdf file: 741929.sdf
directory: 741929

150747-53-8 Ass 52 Ass-52 L-Cysteinamide, N-((1-mercaptocyclohexyl)acetyl)-L-phenylalanyl-D-tryptophyl-L-lysyl-L-threonyl-N-(2-hydroxyethyl)-, cyclic (1-5)-disulfide

pdb file: 741930.pdb
sdf file: 741930.sdf
directory: 741930

157605-25-9 Alatrofloxacin mesylate Alatrofloxacin mesylate [USAN] CP 116,517 CP 116,517-27 L-Alaninamide, L-alanyl-N-(3-(6-carboxy-8-(2,4-difluorophenyl)-3-fluoro-5,8-dihydro-5-oxo-1,8-naphthridin-2-yl)-3-azabicyclo(3.1.0)hex-6-yl)-, (1alpha,5alpha,6alpha)-, monomethanesulfonate L-Alanyl-N-(3-(6-carboxy-8-(2,4-difluorophenyl)-3-fluoro-5,8-dihydro-5-oxo-1,8-naphthridin-2-yl)-3-azabicyclo(3.1.0)hex-6-yl)-L-alaninamide (1alpha,5alpha,6alpha)-, monomethanesulfonate Trovan-IV

pdb file: 741944.pdb
sdf file: 741944.sdf
directory: 741944

163136-31-0 2,3,4,5-Tetradehydroprolyl-2-aminobutanoyl-seryl-3-phenyl-beta-alanyl-2-aminobutanoic acid Asterinin D Butanoic acid, 2,3,4,5-tetradehydroprolyl-L-2-aminobutanoyl-L-seryl-(R)-3-phenyl-beta-alanyl-L-2-amino- delta(2,4)-Pro-L-abu-L-ser-L-betaphe-L-abu delta(2,4)-Pro-abu-ser-betaphe-abu

pdb file: 741951.pdb
sdf file: 741951.sdf
directory: 741951

172228-98-7 L-Asparaginyl-L-threonyl-L-tryptophyl-L-threonyl-L-threonyl-L-cysteinyl-L-glutaminyl-L-seryl-L-isoleucyl-L-alanyl-L-phenylalanyl-L-prolyl-L-seryl-L-lysine L-Lysine, L-asparaginyl-L-threonyl-L-tryptophyl-L-threonyl-L-threonyl-L-cysteinyl-L-glutaminyl-L-seryl-L-isoleucyl-L-alanyl-L-phenylalanyl-L-prolyl-L-seryl- Plp 178-91 Proteolipid protein 178-191

pdb file: 741954.pdb
sdf file: 741954.sdf
directory: 741954

3-Phe-oxytocin 30627-23-7 4366-59-0 642-35-3 Cys-tyr-phe-gln-asn-cys-pro-leu-glynh2 Cysteinyl-tyrosyl-phenylalanyl-glutaminyl-asparaginyl-cysteinyl-proly-leucyl-glycinamide Oxypressin Oxytocin, 3-L-phenylalanine- Oxytocin, phe(3)- Oxytocin, phenylalanine(3)-

pdb file: 742165.pdb
sdf file: 742165.sdf
directory: 742165

(1-10)Corticotropin 2791-05-1 4037-00-7 Acth (1-10) Acth(1-10) Glycine, N-(N-(N2-(N-(N-(N-(N-(N-(N-L-seryl-L-tyrosyl)-L-seryl)-l-methionyl)-L-alpha-glutamyl)-L-histidyl)-L-phenylalanyl)-L-arginyl)-L-tryptophyl)- Human ACTH(1-10)

pdb file: 742503.pdb
sdf file: 742503.sdf
directory: 742503

3801-77-2 L-Alanine, N-(N-(trifluoroacetyl)-L-phenylalanyl)- N-Tfa-phenylalanyl-alanine N-Trifluoroacetylphenylalanylalanine Tfa-phe-ala

pdb file: 742628.pdb
sdf file: 742628.sdf
directory: 742628

4086-29-7 5-10 Acth Acth (5-10) Acth(5-10) Corticotropin, 5-10- Glycine, N-(N-(N2-(N-(N-L-alpha-glutamyl-L-histidyl)-L-phenylalanyl)-L-arginyl)-L-tryptophyl)-

pdb file: 742647.pdb
sdf file: 742647.sdf
directory: 742647

2,5-Piperazinedione, 3,6-dimethyl-, (3S-cis)- 5845-61-4 Cyclic(ala-ala) Cyclo(ala-ala) Cyclo(alanylalanyl)

pdb file: 742823.pdb
sdf file: 742823.sdf
directory: 742823

183552-38-7 Abarelix Abarelix [USAN] D-Alaninamide, N-acetyl-3-(2-naphthalenyl)-D-alanyl-4-chloro-D-phenylalanyl-3-(3-pyridinyl)-D-alanyl-L-seryl-N-methyl-L-tyrosyl-D-asparaginyl-L-leucyl-N6-(1-methylethyl)-L-lysyl-L-prolyl- 10 N-Acetyl-3-(2-naphthyl)-D-alanyl-4-chloro-D-phenylalanyl-3-(3-pyridyl)-D-alanyl-L-seryl-N-methyl-L-tyrosyl-D-asparginyl-L-leucyl-N6-isopropyl-L-lysyl-L-prolyl-D-alaninamide PPI 149 PPI-149 Plenaxis R 3827

pdb file: 743918.pdb
sdf file: 743918.sdf
directory: 743918

15545-21-8 Adenosine, 3'-((2-((2-(acetylamino)-1-oxo-3-phenylpropyl)amino)-3-(4-methoxyphenyl)-1-oxopropyl)amino)-3'-deoxy-N,N-dimethyl-, (S-(R*,R*))- N-Ac-Phe-puromycin N-Acetylphenylalanylpuromycin

pdb file: 744736.pdb
sdf file: 744736.sdf
directory: 744736

16124-22-4 D-Alanine, N-(N-(N2-(N-(N-(N-acetyl-alpha-muramoyl)-L-alanyl)-D-gamma-glutamyl)-(R*,S*)-6-carboxylysyl)-D-alanyl)-, 1'-P'-ester with uridine 5'-(trihydrogen diphosphate) UDP-murnac-pentapeptide Udp-N-acetylmuramic acid pentapeptide Udp-N-acetylmuramic acid pentapeptides

pdb file: 744958.pdb
sdf file: 744958.sdf
directory: 744958

20314-31-2 L-Alaninamide, L-lysyl-N-2-naphthalenyl- Lys-ala-beta NA Lysyl-alanyl-beta-naphthylamide

pdb file: 745355.pdb
sdf file: 745355.sdf
directory: 745355

23815-87-4 8-De-phe-9-de-arg-bradykinin 8-Des-phe-9-des-arg-BK Bradykinin, 8-de(L-phenylalanine)-9-de-L-arginine- Bradykinin, des-phe(8)-des-arg(9)- Bradykinin, des-phenylalanyl(8)-des-arginine(9)- Des-8,9-BK Des-phe(8)-arg(9)-BK

pdb file: 745611.pdb
sdf file: 745611.sdf
directory: 745611

26701-37-1 L-Lysine, polymer with L-alanine Poly(DL-alanyl)-poly(L-lysine) Poly(ala)-poly(lys)

pdb file: 746090.pdb
sdf file: 746090.sdf
directory: 746090

27879-92-1 9059-61-4 Alanine-glycine polymers Glycine-alanine polymers L-Alanine, polymer with glycine Poly(ala-gly) Poly(alanylglycine)

pdb file: 746247.pdb
sdf file: 746247.sdf
directory: 746247

38104-40-4 73777-48-7 Aapack L-Prolinamide, N-acetyl-L-alanyl-L-alanyl-N-(3-chloro-1-methyl-2-oxopropyl)-, (S)- N-Acetyl-ala-ala-pro-ala-chloromethyl ketone N-Acetylalanyl-alanyl-prolyl-alanine chloromethyl ketone

pdb file: 747533.pdb
sdf file: 747533.sdf
directory: 747533

126268-88-0 3,7-Ddmc LR 3,7-Didesmethylmicrocystin LR Cyclo(2,3-didehydroalanyl-D-alanyl-L-leucyl-D-beta-aspartyl-L-arginyl-(2S,4E,6E,8S,9S)-4,5,6,7-tetradehydro-9-methoxy-2,6,8-trimethyl-10-phenyl-L-3-aminodecanoyl-D-gamma-glutamyl)

pdb file: 747853.pdb
sdf file: 747853.sdf
directory: 747853

154336-13-7 28-Mephe-31-N-meile-cck (26-33) Cholecystokinin (26-33), mephe(28)-N-meile(31)- Cholecystokinin (26-33), methylphenylalanyl(28)-N-methylnorisoleucyl(31)- L-Phenylalaninamide, L-alpha-aspartyl-L-tyrosyl-erythro-beta-methyl-D-phenylalanylglycyl-L-tryptophyl-N-methyl-L-norleucyl-L-alpha-aspartyl- Snf 8815 Snf-8815

pdb file: 747855.pdb
sdf file: 747855.sdf
directory: 747855

1-(D-3-Phenyl-beta-alanine)edeine A1 40627-96-1 Edeine D L-Alaninamide, (S)-3-phenyl-beta-alanyl-(S)-2-hydroxy-beta-alanyl-3-amino-N-(5-amino-8-((2-((3-((4-aminobutyl)amino)propyl)amino)-2-oxoethyl)amino)-1-carboxy-6-hydroxy-8-oxooctyl)-, (1R-(1R*,5S*,6R*))-

pdb file: 747930.pdb
sdf file: 747930.sdf
directory: 747930

51943-80-7 Glycinamide, L-alanylglycyl-L-glutaminyl-N-(2-(1H-imidazol-4-yl)ethyl)- Procamine

pdb file: 748620.pdb
sdf file: 748620.sdf
directory: 748620

(1-((2-Amino-1-oxopropyl)amino)ethyl)phosphonic acid 54788-43-1 N-D-Alanyl-1-aminoethylphosphonic acid Phosphonic acid, (1-((2-amino-1-oxopropyl)amino)ethyl)-

pdb file: 748908.pdb
sdf file: 748908.sdf
directory: 748908

55207-83-5 Hgh (6-13) Human growth hormone (6-13) L-Alanine, N-(N2-(N-(N-(N-(N2-(N-L-leucyl-L-seryl)-L-arginyl)-L-leucyl)-L-phenylalanyl)-L-alpha-aspartyl)-L-asparaginyl)- Somatotropin (6-13)

pdb file: 748952.pdb
sdf file: 748952.sdf
directory: 748952

55599-68-3 A-3309-B Antibiotic A 3302A, 1-(N-acetyl-D-phenylalanine)- Antibiotic A 3302B Antibiotic TL 119 N-Acetylphenylalanylleucylphenylalanylthreonylvalylalanyl-2-amino-2-butenoic acid, lambda-lactone TL 119

pdb file: 748989.pdb
sdf file: 748989.sdf
directory: 748989

55677-48-0 Boc-phe-ala Boc-phenylalanyl-alanine L-Alanine, N-(N-((1,1-dimethylethoxy)carbonyl)-L-phenylalanyl)- t-Butyloxycarbonylphenylalanylalanine

pdb file: 748995.pdb
sdf file: 748995.sdf
directory: 748995

56897-53-1 Carcinine Propanamide, 3-amino-N-(2-(1H-imidazol-4-yl)ethyl)- beta-Alanylhistamine

pdb file: 749077.pdb
sdf file: 749077.sdf
directory: 749077

66004-57-7 Hgh (176-191) Human growth hormone (176-191) L-Phenylalanine, L-phenylalanyl-L-leucyl-L-arginyl-L-isoleucyl-L-valyl-L-glutaminyl-L-cysteinyl-L-arginyl-L-seryl-L-valyl-L-alpha-glutamylglycyl-L-seryl-L-cysteinylglycyl-, cyclic (7-14)-disulfide Somatotropin (176-191)

pdb file: 749248.pdb
sdf file: 749248.sdf
directory: 749248

66157-45-7 C 3a-Hexapeptide C3a(72-77) C3a-Hexapeptide Complement 3a-hexapeptide L-Arginine, N2-(N-(N-(N-(N-L-histidyl-L-leucyl)glycyl)-L-leucyl)-L-alanyl)-

pdb file: 749279.pdb
sdf file: 749279.sdf
directory: 749279

66649-46-5 L-Phenylalaninamide, L-tyrosyl-D-alanylglycyl- TAGPA Tetrapeptamide Tyr-ala-gly-phe-NH2 Tyrosyl alanyl-glycyl-phenylalaninamide

pdb file: 749321.pdb
sdf file: 749321.sdf
directory: 749321

66851-75-0 Acp (65-74) Acyl carrier protein (65-74) Glycine, N-(N2-(N-(N-(N-(N-(N-(N-(N2-L-valyl-L-glutaminyl)-L-alanyl)-L-alanyl)-L-isoleucyl)-L-alpha-aspartyl)-L-tyrosyl)-L-isoleucyl)-L-asparaginyl)-

pdb file: 749329.pdb
sdf file: 749329.sdf
directory: 749329

67494-32-0 EINECS 266-705-2 Glycylglycylglycyl-L-cysteinyl-L-tyrosyl-3-phenyl-L-alanyl-L-glutaminyl-L-asparaginyl-L-cysteinyl-L-prolyl-L-lysine (4.9)-disulphide, cyclic Vasopressin, N-alpha-gly-gly-gly-8-lys-9-des-glynh2-

pdb file: 749353.pdb
sdf file: 749353.sdf
directory: 749353

70555-24-7 Cystinyl-gly Cystinylglycine Gly, N-(3-((2-amino-2-carboxyethyl)dithio)-ala)-,(R)- Glycine, L-cysteinyl-, (1-1')-disulfide with L-cysteine Glycine, N-(3-((2-amino-2-carboxyethyl)dithio)-L-alanyl)-, (R)-

pdb file: 749998.pdb
sdf file: 749998.sdf
directory: 749998

1-(N-(1-L-Tyrosyl-L-prolyl)-L-phenylalanyl)-L-proline 74171-19-0 L-Proline, 1-(N-(1-L-tyrosyl-L-prolyl)-L-phenylalanyl)- Tyr-pro-phe-pro Tyrosyl-prolyl-phenylalanyl-proline beta-Casomorphin 4 beta-Casomorphin 4 (ox)

pdb file: 750647.pdb
sdf file: 750647.sdf
directory: 750647

74240-44-1 Glycine, 3-amino-N-(1-oxohexadecyl)-L-alanyl-L-seryl-L-seryl-3-((aminocarbonyl)amino)-2,3-didehydroalanyl-L-2-(2-amino-1,4,5,6-tetrahydro-4-pyrimidinyl)-, cyclic (5-1)-peptide, (4(Z),5(R))- PTAN Palmitoyl tuberactinamine N

pdb file: 750656.pdb
sdf file: 750656.sdf
directory: 750656

74604-22-1 D-Serinamide, N-methyl-L-tyrosyl-D-serylglycyl-N-methyl-L-phenylalanyl- N-Me-Tyr-D-ser-gly-N-Me-phe-D-ser-NH2 Wy 42896 Wy-42,896

pdb file: 750684.pdb
sdf file: 750684.sdf
directory: 750684

(Ac-Dehydro-pro(1),p-Cl-D-phe(2),D-trp(3,6))-N-(alpha)-meleu(7)-gnrh (Acetyl-dehydro-1-prolyl-p-Cl-phenylalanyl-3,6-tryptophyl)-N-(alpha)-methyl-7-leucine-gnrh 74611-71-5 Apptl-gnrh GNRH, (Ac-dehydro-pro(1)-4-Cl-phe(2)-trp(3,6))-N-(alpha)-meleu(7)- GNRH, (Ac-dehydro-pro(1)-p-Cl-phe(2)-trp(3,6))-N-(alpha)-meleu(7)- Glycinamide, 1-acetyl-3,4-didehydro-L-prolyl-4-chloro-D-phenylalanyl-D-tryptophyl-L-seryl-L-tyrosyl-D-tryptophyl-N-methyl-L-leucyl-L-arginyl-L-prolyl-

pdb file: 750685.pdb
sdf file: 750685.sdf
directory: 750685

7-Phe-acth amide (1-10) 74873-14-6 ACTH - NH2 (1-10), phenylalanine(7)- ACTH amide (1-10), phe(7)- Glycinamide, L-seryl-L-tyrosyl-L-seryl-L-methionyl-L-alpha-glutamyl-L-histidyl-D-phenylalanyl-L-arginyl-L-tryptophyl-

pdb file: 750706.pdb
sdf file: 750706.sdf
directory: 750706

2-Ala-dynorphin (1-11) 75491-15-5 Ala-dynorphin Dynorphin (1-11), ala(2)- Dynorphin (1-11), alanine(2)- L-Lysine, N(2)-(1-(N(2)-(N-(N(2)-(N(2)-(N-(N-(N-(N-L-tyrosyl-D-alanyl)glycyl)-L-phenylalanyl)-L-leucyl)-L-arginyl)-L-arginyl)-L-isoleucyl)-L-arginyl)-L-prolyl)- L-Lysine, N2-(1-(N2-(N-(N2-(N2-(N-(N-(N-(N-L-tyrosyl-D-alanyl)glycyl)-L-phenylalanyl)-L-leucyl)-L-arginyl)-L-arginyl)-L-isoleucyl)-L-arginyl)-L-prolyl)-

pdb file: 750785.pdb
sdf file: 750785.sdf
directory: 750785

3-Carboxypropionyl-alanyl-alanyl-valine-4-nitroanilide 61043-47-8 EINECS 262-569-3 L-Valinamide, N-(3-carboxy-1-oxopropyl)-L-alanyl-L-alanyl-N-(4-nitrophenyl)- N-(3-Carboxy-1-oxopropyl)-L-alanyl-L-alanyl-N-(4-nitrophenyl)-L-valinamide

pdb file: 751122.pdb
sdf file: 751122.sdf
directory: 751122

4-Phenylalanylaminoantipyrine 62989-74-6 Benzenepropanamide, alpha-amino-N-(2,3-dihydro-1,5-dimethyl-3-oxo-2-phenyl-1H-pyrazol-4-yl)-,(+-)- DL-Phenylalanine-4-antipyrineamide TJ 4

pdb file: 751223.pdb
sdf file: 751223.sdf
directory: 751223

4-Alanylaminoantipyrine 62989-75-7 DL-Alanine-4-antipyrineamide Propanamide, 2-amino-N-(2,3-dihydro-1,5-dimethyl-3-oxo-2-phenyl-1H-pyrazol-4-yl)-, (+-)- WK 32

pdb file: 751224.pdb
sdf file: 751224.sdf
directory: 751224

65144-33-4 L-Prolinamide, N-(3-carboxy-1-oxopropyl)-L-alanyl-L-alanyl-N-(3-chloro-1-(1-methylethyl)-2-oxopropyl)-, (S)- Saapvc Suc-ala-ala-pro-val-chloromethyl ketone Succinyl-alanyl-alanyl-prolyl-valine chloromethyl ketone

pdb file: 751396.pdb
sdf file: 751396.sdf
directory: 751396

65147-21-9 L-Argininamide, L-prolyl-L-phenylalanyl-N-(4-methyl-2-oxo-2H-1-benzopyran-7-yl)- Pro-phe-arg-mca Prolyl-phenylalanyl-arginine-4-methylcoumaryl-7-amide

pdb file: 751397.pdb
sdf file: 751397.sdf
directory: 751397

78493-49-9 D-Alaninamide, N-acetyl-4-fluoro-D-phenylalanyl-4-chloro-D-phenylalanyl-D-tryptophyl-L-seryl-L-tyrosyl-D-tryptophyl-L-leucyl-L-arginyl-L-prolyl- GNRH, N-Ac-(4-F-phe)(1)-(4-Cl-phe)(2)-trp(3,6)-alanh2(10)- LHRH, N-ac-(4-F-Phe)(1)-(4-Cl-phe)(2)-trp(3,6)-alanh2(10)- LHRH-N-Acetyl-4-fluorophenylalanyl(1)-4-chlorophenylalanyl(2)-tryptophyl(3,6)-alaninamide(10)- N-Ac-1-(4-F-Phe)-2-(4-Cl-phe)-3,6-trp-alanh2-LHRH Naf-pcptal

pdb file: 751452.pdb
sdf file: 751452.sdf
directory: 751452

78505-11-0 CH3Hg-SG Complex Glutathione-methylmercury complex Glycine, N-(N-L-gamma-glutamyl-3-(methylmercurio)-L-alanyl)- MMGTH Methylmercury glutathione

pdb file: 751453.pdb
sdf file: 751453.sdf
directory: 751453

81608-55-1 D-Alaninamide, N-acetyl-4-chloro-D-phenylalanyl-4-chloro-D-phenylalanyl-D-tryptophyl-L-seryl-L-tyrosyl-D-alanyl-L-leucyl-L-arginyl-L-prolyl-, (S)- GNRH, N-Ac-(4-Cl-phe)(1)-(4-Cl-phe)(2)-trp(3)-lys(6)-alanh2(10)- LHRH, N-ac-(4-Cl-Phe)(1)-(4-Cl-phe)(2)-trp(3)-lys(6)-alanh2(10)- LHRH-N-Acetyl-4-chlorophenylalanyl(1)-4-chlorophenylalanyl(2)-tryptophyl(3)-lysyl(6)-alaninamide(10)- N-Ac-1-(4-Cl-Phe)-2-(4-Cl-phe)-3-trp-6-lys-10-alanh2-LHRH Ptla-LHRH

pdb file: 751547.pdb
sdf file: 751547.sdf
directory: 751547

81788-49-0 Enkephalin-met, tyr-O-sulfate Enkephalin-met, tyrosine-O-sulfate- L-Methionine, N-(N-(N-(N-(O-sulfo-L-tyrosyl)glycyl)glycyl)-L-phenylalanyl)- METOS Met-enkephalin, tyr-O-sulfate- Methionine-enkephalin, tyr-O-sulfate- Tyr-O-sulfate-met-enkephalin

pdb file: 751555.pdb
sdf file: 751555.sdf
directory: 751555

(4-1')-Disulfide 6-cys-argipressin (3-9) 84953-76-4 Agripressin (3-9), (4-1')-disulfide cysteine(6)- Arginine vasopressin (3-9), (4-1')-disulfide cys(6)- Argipressin (3-9), (4-1')-disulfide cys(6)- Cyt(6)-avp(3-9) Glycinamide, L-phenylalanyl-L-glutaminyl-L-asparaginyl-L-cysteinyl-L-prolyl-L-arginyl-, (4-1')-disulfide with L-cysteine

pdb file: 751691.pdb
sdf file: 751691.sdf
directory: 751691

1-N-Ac-Trp-2-(4-Cl-phe)-3-trp-6-arg-10-ala-LHRH 86044-76-0 Actcaa-LHRH D-Alaninamide, N-acetyl-D-tryptophyl-4-chloro-D-phenylalanyl-D-tryptophyl-L-seryl-L-tyrosyl-D-arginyl-L-leucyl-L-arginyl-L-prolyl-, (2S-(2alpha,3alpha(S*),5alpha,6beta))- GNRH, N-Ac-trp(1)-(4-Cl-phe)(2)-trp(3)-arg(6)-ala(10)- LHRH, N-ac-Trp(1)-(4-Cl-phe)(2)-trp(3)-arg(6)-ala(10)- LHRH-N-Acetyltryptophyl(1)-4-chlorophenylalanyl(2)-tryptophyl(3)-arginyl(6)-alanine(10)- Lrh 147 N-Acetyl-1,3-tryptophyl-2-p-chlorophenylalanyl-6-arginyl-10-alanine-LHRH

pdb file: 751820.pdb
sdf file: 751820.sdf
directory: 751820

1-N-Ac-Naphthyl-2-(4-Cl-phe)-3-trp-6-arg-10-ala-LHRH 86044-78-2 D-Alaninamide, N-acetyl-3-(1-naphthalenyl)-D-alanyl-4-chloro-D-phenylalanyl-D-tryptophyl-L-seryl-L-tyrosyl-D-arginyl-L-leucyl-L-arginyl-L-prolyl- GNRH, N-Ac-naphthyl(1)-(4-Cl-phe)(2)-trp(3)-arg(6)-ala(10)- LHRH, N-Acetylnaphthyl(1)-4-chlorophenylalanyl(2)-tryptophyl(3)-arginyl(6)-alanine(10)- LHRH, N-ac-Naphthyl(1)-(4-Cl-phe)(2)-trp(3)-arg(6)-ala(10)- LHRH-Nptaa

pdb file: 751821.pdb
sdf file: 751821.sdf
directory: 751821

1-Deaminopentamethylene-2-phe-4-ile-argipressin 1-Dpiav 86785-86-6 Arginine vasopressin, 1-deamino-pentamethylene-phe(2)-ile(4)- Argipressin, 1-deamino-pentamethylene-phe(2)-ile(4)- Argipressin, 1-deaminopentamethylene-phe(2)-ile(4)- Argipressin, 1-deaminopentamethylene-phenylalanyl(2)-isoleucine(4)- Dppi-avp Vasopressin, 1-(1-mercaptocyclohexaneacetic acid)-2-D-phenylalanine-4-L-isoleucine-8-L-arginine-

pdb file: 751855.pdb
sdf file: 751855.sdf
directory: 751855

4-Pro-7,9,10-trp-substance P (4-11) 4-Prolyl-7,9,10-tryptophan-substance P (4-11) 83334-92-3 86917-57-9 Gpant-1 L-Methioninamide, L-prolyl-L-glutaminyl-L-glutaminyl-L-tryptophyl-L-phenylalanyl-L-tryptophyl-L-tryptophyl- Pttt-SP(4-11) Substance P (4-11), pro(4)-trp(7,9,10)- Substance P (4-11), prolyl(4)-tryptophan(7,9,10)-

pdb file: 751881.pdb
sdf file: 751881.sdf
directory: 751881

(2-Amino-4-(4-methoxyphenyl)butanoic acid)-AM toxin I (L-2-Amino-4-(p-methoxxyphenyl)butanoic acid)-AM toxin I (L-Amb3)-AM toxin I 87105-09-7 AM Toxin I, (2-amino-4-(4-methoxyphenyl)butanoic acid)- AM Toxin I, ampba- L-Alanine, N-(2-hydroxy-3-methyl-1-oxobutyl)-gamma-(4-methoxyphenyl)-L-alpha-aminobutyryl-2,3-didehydroalanyl-, (S)-

pdb file: 751898.pdb
sdf file: 751898.sdf
directory: 751898

(2-Amino-6-(4-methoxyphenyl)hexanoic acid)-AM toxin I (L-2-Amino-6-(p-methoxyphenyl)hexanoic acid)-AM toxin I (L-Amh3)-AM toxin I 87105-10-0 AM Toxin I, (2-amino-6-(4-methoxyphenyl)hexanoic acid)- Ampha-AM toxin I L-Alanine, N-(2,3-didehydro-N-(N-(2-hydroxy-3-methyl-1-oxobutyl)-6-(4-methoxyphenyl)-L-norleucyl)alanyl)-, (S)-

pdb file: 751899.pdb
sdf file: 751899.sdf
directory: 751899

89187-22-4 Hgh (32-46) Human growth hormone (32-46) L-Glutamine, L-alpha-glutamyl-L-alpha-glutamyl-L-alanyl-L-tyrosyl-L-isoleucyl-L-prolyl-L-lysyl-L-alpha-glutamyl-L-glutaminyl-L-lysyl-L-tyrosyl-L-seryl-L-phenylalanyl-L-leucyl- Somatotropin (32-46)

pdb file: 752020.pdb
sdf file: 752020.sdf
directory: 752020

4-Pro-7,9,10-trp-11-phe-substance P 89457-20-5 Dpdtp-octa L-Phenylalaninamide, D-prolyl-L-glutaminyl-L-glutaminyl-D-tryptophyl-L-phenylalanyl-D-tryptophyl-D-tryptophyl- Substance P (4-11), pro(4)-trp-(7,9,10)-phe(11)- Substance P (4-11), prolyl-(4)-tryptophyl(7,9,10)-phenylalanine(11)-

pdb file: 752035.pdb
sdf file: 752035.sdf
directory: 752035

90965-60-9 D-Lysinamide, N6-(N-(N-(N-acetylmuramoyl)-L-alanyl)-D-gamma-glutamyl)-6-carboxy-, erythro- Muracein A

pdb file: 752102.pdb
sdf file: 752102.sdf
directory: 752102

90965-61-0 D-Alanine, N-(N-acetylmuramoyl)-L-alanyl-D-gamma-glutamyl-7-oxo-L-erythro-2,6,7-triaminoheptanoyl-D-alanyl- Muracein B

pdb file: 752103.pdb
sdf file: 752103.sdf
directory: 752103

2-Ala-N-(2-(dimethylamino)ethyl)-N-(alpha)-Me-N-oxy-4-phenh2-enkephalin 72080-55-8 Enkephalin, ala(2)-N-(2-(dimethylamino)ethyl)-N(alpha)-methyl-N-oxy-phenh2(4)- Enkephalin, alanyl (2)-N-(2-(dimethylamino)ethyl)-N(alpha)-methyl-N-oxy-phenylalaninamide(4)- L-Phenylalaninamide, L-tyrosyl-D-alanylglycyl-N-(2-(dimethylamino)ethyl)-N(alpha)-methyl-, N-oxide RX 783030 RX-783030

pdb file: 752179.pdb
sdf file: 752179.sdf
directory: 752179

73385-60-1 L-Prolinamide, L-tyrosyl-gamma-(methylsulfinyl)-D-alpha-aminobutyrylglycyl-4-nitro-L-phenylalanyl- Nifalatide Tyr-met-gly-(4-nitrophenyl)-ala-pronh2 S-oxide Tyrosyl-methionyl-glycyl-4-nitrophenylalanyl-prolinamide S-oxide

pdb file: 752685.pdb
sdf file: 752685.sdf
directory: 752685

104840-34-8 Bagougeramine B beta-D-Glucopyranuronamide, N-(3-((4-aminobutyl)amino)propyl)-4-((3-((aminoiminomethyl)amino)-N-(N-methylglycyl)-D-alanyl)amino)-1-(4-amino-2-oxo-1(2H)-pyrimidinyl)-1,4-dideoxy-

pdb file: 753187.pdb
sdf file: 753187.sdf
directory: 753187

105931-25-7 L-Asparaginyl-L-leucyl-L-alpha-glutamyl-L-arginyl-L-alpha-glutamyl-L-cysteinyl-L-leucyl-L-alpha-glutamyl-L-alpha-glutamyl-L-prolyl-L-cysteinyl-L-seryl-L-arginyl-L-alpha-glutamyl-L-alpha-glutamyl-L-alanyl-L-phenylalanine cyclic(6-11)-disulfide L-Phenylalanine, L-asparaginyl-L-leucyl-L-alpha-glutamyl-L-arginyl-L-alpha-glutamyl-L-cysteinyl-L-leucyl-L-alpha-glutamyl-L-alpha-glutamyl-L-prolyl-L-cysteinyl-L-seryl-L-arginyl-L-alpha-glutamyl-L-alpha-glutamyl-L-alanyl-, cyclic(6-11)-disulfide Prothrombin precursor (13-29)

pdb file: 753216.pdb
sdf file: 753216.sdf
directory: 753216

108675-63-4 Cyclo(L-alanyl-(2S,4E,6R,8S)-8-hydroxy-2,4,6-trimethyl-4-nonenoyl-L-alanyl-3-iodo-N-methyl-D-tyrosyl) Geodiamolide A L-Alanine, N-(N-(N-(8-hydroxy-2,4,6-trimethyl-1-oxo-4-nonenyl)-L-alanyl)-3-iodo-N-methyl-D-tyrosyl)-, pi-lactone, (2S-(2R*,4E,6S*,8R*))-

pdb file: 753290.pdb
sdf file: 753290.sdf
directory: 753290

1-N-Ac-(4-Cl-Phe)-2-(4-Cl-phe)-3-trp-6-Et2-harg-10-ala-LHRH 109458-76-6 D-Alanine, N-(1-(N2-(N-(N2-(N-(N-(N-(N-(N-acetyl-4-chloro-D-phenylalanyl)-4-chloro-D-phenylalanyl)-D-tryptophyl)-L-seryl)-L-tyrosyl)-N6-(bis(ethylamino)methylene)-D-lysyl)-L-leucyl)-L-arginyl)-L-prolyl)- GNRH, N-Ac-4-Cl-phe(1)-(4-Cl-phe)(2)-trp(3)-Et2-harg(6)-ala(10)- LHRH, N-Acetyl-4-chlorophenylalanyl(1)-(4-chlorophenylalanyl)(2)-tryptophyl(3)-diethylhomoarginyl(6)-alanine(10)- LHRH, N-ac-4-Cl-Phe(1)-(4-Cl-phe)(2)-trp(3)-Et2-harg(6)-ala(10)- RS 18286 RS-18286

pdb file: 753322.pdb
sdf file: 753322.sdf
directory: 753322

188968-51-6 Cilengitide Cilengitide [USAN:INN] Cyclo(L-arginylglycyl-L-aspartyl-D-phenylalanyl-N-methyl-L-valyl) EMD 121974

pdb file: 754074.pdb
sdf file: 754074.sdf
directory: 754074

174973-65-0 L-Isoleucine, L-alanyl-L-lysyl-L-lysyl-L-lysyl-L-alpha-aspartyl-L-leucyl-L-asparaginyl-L-alpha-glutamyl-L-alpha-aspartylglycyl-L-arginyl-L-valyl-L-asparaginyl-L-seryl-L-threonyl-L-alpha-aspartyl-L-leucylglycyl-L-isoleucyl-L-leucyl-L-lysyl-L-arginyl-L-tyrosyl-L-isoleucyl-L-leucyl-L-lysyl-L-alpha-glutamyl-

pdb file: 754514.pdb
sdf file: 754514.sdf
directory: 754514

159427-08-4 159628-71-4 159704-78-6 L-Threoninamide, N-acetyl-L-histidyl-L-seryl-L-alpha-aspartyl-L-alanyl-L-valyl-L-phenylalanyl-L-threonyl-L-alpha-glutamyl-L-asparaginyl-L-tyrosyl-L-threonyl-L-lysyl-L-leucyl-L-arginyl-L-lysyl-L-glutaminyl-L-norleucyl-L-alanyl-L-alanyl-L-lysyl-L-lysyl-L-tyrosyl-L-leucyl-L-asparaginyl-L-alpha-aspartyl-L-leucyl-L-lysyl-L-lysylglycylglycyl-, (25-21)-lactam Ro 25-1553 Vasoactive intestinal octacosapeptide (pig), N-acetyl-8-L-glutamic acid-12-L-lysine-17-L-norleucine-19-L-alanine-25-L-aspartic acid-26-L-leucine-27-L-lysine-28-L-lysine-28a-glycine-28b-glycine-28c-L-threoninamide-, cyclic (25-21)-peptide

pdb file: 755248.pdb
sdf file: 755248.sdf
directory: 755248

85754-59-2 Ambamustine Ambamustine [INN] N-(3-(m-(Bis(2-chloroethyl)amino)phenyl)-N-(3-(p-fluorophenyl)-L-alanyl)-L-alanyl)-L-methionine, ethyl ester

pdb file: 755358.pdb
sdf file: 755358.sdf
directory: 755358

117665-48-2 L-Serinamide, glycyl-L-isoleucylglycyl-L-lysyl-L-phenylalanyl-L-leucyl-L-histidyl-L-alanyl-L-alanyl-L-lysyl-L-lysyl-L-phenylalanyl-L-alanyl-L-lysyl-L-alanyl-L-phenylalanyl-L-valyl-L-alanyl-L-alpha-glutamyl-L-isoleucyl-L-methionyl-L-asparaginyl- Magainin B Magainin I, 8-L-alanine-10-L-lysine-13-L-alanine-18-L-alanine-22-L-asparagine-23-L-serinamide-

pdb file: 761136.pdb
sdf file: 761136.sdf
directory: 761136

108233-39-2 Glycine, 3-(((2E)-4-methoxy-1,4-dioxo-2-butenyl)amino)-L-alanyl- Glycine, N-(3-((4-methoxy-1,4-dioxo-2-butenyl)amino)-L-alanyl)-, (E)- N3-4-Methoxyfumaroyl-L-2,3-diaminopropanoic acid

pdb file: 761282.pdb
sdf file: 761282.sdf
directory: 761282

108233-94-9 Cyclo(D-alanyl-L-leucyl-(Z)-alpha,beta-didehydrophenylalanylglycyl)

pdb file: 761283.pdb
sdf file: 761283.sdf
directory: 761283

108233-95-0 Cyclo(L-alanyl-L-leucyl-(Z)-alpha,beta-didehydro-N-methylphenylalanylglycyl)

pdb file: 761284.pdb
sdf file: 761284.sdf
directory: 761284

108233-96-1 Glycine, N-((Z)-alpha,beta-didehydro-N-(N-(N-methyl-L-alanyl)-L-leucyl)phenylalanyl)-

pdb file: 761285.pdb
sdf file: 761285.sdf
directory: 761285

108233-97-2 Glycine, N-(N-(N-L-alanyl-D-leucyl)-(Z)-alpha,beta-didehydrophenylalanyl)-

pdb file: 761286.pdb
sdf file: 761286.sdf
directory: 761286

108233-98-3 Glycine, N-(N-(N-L-alanyl-L-leucyl)-(Z)-alpha,beta-didehydro-N-methylphenylalanyl)-

pdb file: 761287.pdb
sdf file: 761287.sdf
directory: 761287

108340-83-6 Cyclo(L-alanyl-L-leucyl-(Z)-alpha,beta-didehydrophenylalanylglycyl)

pdb file: 761299.pdb
sdf file: 761299.sdf
directory: 761299

108340-84-7 Cyclo(N-methyl-L-alanyl-L-leucyl-(Z)-alpha,beta-didehydrophenylalanylglycyl)

pdb file: 761300.pdb
sdf file: 761300.sdf
directory: 761300

108340-85-8 Cyclo(L-alanyl-D-leucyl-(Z)-alpha,beta-didehydro-N-methylphenylalanylglycyl)

pdb file: 761301.pdb
sdf file: 761301.sdf
directory: 761301

108340-86-9 Cyclo(L-alanyl-D-leucyl-(Z)-alpha,beta-didehydrophenylalanylglycyl)

pdb file: 761302.pdb
sdf file: 761302.sdf
directory: 761302

108340-87-0 Glycine, N-((Z)-alpha,beta-didehydro-N-(N-(N-methyl-L-alanyl)-D-leucyl)phenylalanyl)-

pdb file: 761303.pdb
sdf file: 761303.sdf
directory: 761303

135727-57-0 His-trp-ala-ile-gly-his-phe-met-NH2 Histidyl-tryptophyl-alanyl-isoleucyl-glycyl-histidyl-phenylalanyl-methionine amide Methioninamide, histidyl-tryptophyl-alanyl-isoleucyl-glycyl-histidyl-phenylalanyl- Ranatensin M Ranatensin-M

pdb file: 764543.pdb
sdf file: 764543.sdf
directory: 764543

110871-16-4 2-Mercaptoacetyl-L-phenylalanyl-L-phenylalanine 2-Mercaptoacetyl-phenylalanylphenylalanine L-Phenylalanine, N-(N-(mercaptoacetyl)-L-phenylalanyl)- Phelorphan

pdb file: 764545.pdb
sdf file: 764545.sdf
directory: 764545

132930-82-6 2-Ala-6-ser-leu-enkephalin DALES Enkephalin-leu, ala(2)-ser(6)- Enkephalin-leucine, alanyl(2)-serine(6)- L-Serine, N-(N-(N-(N-(N-L-tyrosyl-D-alanyl)glycyl)-L-phenylalanyl)-L-leucyl)- Leu-enkephalin, ala(2)-ser(6)-

pdb file: 765226.pdb
sdf file: 765226.sdf
directory: 765226

1-Metyr-7-mearg-8-leu-dynorphin (1-9)-nhet 103614-28-4 Daeatal Dynorphin A ethylamide (1-9), methyltyrosyl(1)-methylarginyl(7)-leucine(8)- Dynorphin A ethylamide (1-9), metyr(1)-mearg(7)-leu(8)- L-Argininamide, N-methyl-L-tyrosylglycylglycyl-L-phenylalanyl-L-leucyl-L-arginyl-N2-methyl-L-arginyl-D-leucyl-N-ethyl-

pdb file: 765234.pdb
sdf file: 765234.sdf
directory: 765234

88191-66-6 Bis(tyr-pro-phenh2)hydrazide Bis(tyrosyl-prolyl-phenylalaninamide)hydrazide Csmso2 L-Phenylalanine, N-(1-L-tyrosyl-L-prolyl)-, 2-(N-(1-L-tyrosyl-L-prolyl)-L-phenylalanyl)hydrazide

pdb file: 765237.pdb
sdf file: 765237.sdf
directory: 765237

118194-49-3 88191-63-3 Bis(tyr-ala-phenh2)hydrazide Bis(tyrosyl-alanyl-phenylalaninamide)hydrazide DYNO2 L-Phenylalanine, N-(N-L-tyrosyl-D-alanyl)-, 2-(N-(N-L-tyrosyl-D-alanyl)-L-phenylalanyl)hydrazide

pdb file: 765238.pdb
sdf file: 765238.sdf
directory: 765238

2-Alanyl-methionine sulfoxide enkephalinamide 70021-29-3 Butanamide, L-tyrosyl-D-alanylglycyl-L-phenylalanyl-gamma-(methylsulfinyl)-L-alpha-amino- Dala sulfoxide Enkephalinamide-met sulfoxide, ala(2)- Met-sulfoxide-enkephalinamide-ala(2) Methionine sulfoxide enkephalinamide-2-alanine

pdb file: 765247.pdb
sdf file: 765247.sdf
directory: 765247

75590-17-9 D-Val-phe-lys-chloromethyl ketone Valyl-phenylalanyl-lysine chloromethyl ketone

pdb file: 765760.pdb
sdf file: 765760.sdf
directory: 765760

5-Oxo-pro-phe-phe-gly-leu-met-amide 6-Pglu-SP(6-11) 6-Pglu-substance P (6-11) 61123-13-5 E-SP(7-11) L-Methioninamide, 5-oxo-L-prolyl-L-phenylalanyl-L-phenylalanylglycyl-L-leucyl- Substance P (6-11), hexapeptide-pglu(6)- Substance P (6-11), pglu(6)- Substance P (6-11), pyroglutamic acid- Substance P, C-terminal pentapeptide

pdb file: 765849.pdb
sdf file: 765849.sdf
directory: 765849

61756-28-3 Ala-gly-ser-glu Alanyl-glycyl-seryl-glutamic acid L-Glutamic acid, N-(N-(N-L-alanylglycyl)-L-seryl)-

pdb file: 765850.pdb
sdf file: 765850.sdf
directory: 765850

4-Azidopuromycin 6-Dimethylamino-9-(3'-deoxy-3'-(p-azido-L-phenylalanylamino)-beta-D-ribofuranosyl)purine 67607-41-4 Adenosine, 3'-((2-amino-3-(4-azidophenyl)-1-oxopropyl)amino)-3'-deoxy-N,N-dimethyl-, (S)- p-Azidopuromycin para-Azidopuromycin

pdb file: 765867.pdb
sdf file: 765867.sdf
directory: 765867

67706-17-6 L-Phenylalanine, N-(N-(N-L-tyrosyl-D-alanyl)glycyl)- TDAGP Tyr-D-ala-gly-phe Tyrosyl-alanyl-glycyl-phenylalanine

pdb file: 765868.pdb
sdf file: 765868.sdf
directory: 765868

127819-97-0 Cyclo(3-(2-naphthalenyl)-D-alanyl-L-isoleucyl-D-2-piperidinecarbonyl-L-2-piperidinecarbonyl-D-histidyl-L-prolyl) Cyclo(pro-nal-ile-pip-pip-his) Cyclo(prolyl-naphthylalanyl-isoleucyl-pipecolyl-pipecolyl-histidyl) L 366,948 L 366948 L-366948

pdb file: 765898.pdb
sdf file: 765898.sdf
directory: 765898

135048-17-8 AC-6-(4-Cl-Phe)-8-trp-somatostatin (3-14) BM 2-28 Bim 23003 Bim-23003 Somatostatin (3-14), Ac-(4-Cl-phe)(6)-trp(8)- Somatostatin (3-14), acetyl-4-chloro-phenylalanyl(6)-tryptophan(8)- Somatostatin (sheep), 1-de-L-alanine-2-deglycine-3-(N-acetyl-L-cysteine)-6-(4-chloro-L-phenylalanine)-8-D-tryptophan-

pdb file: 766410.pdb
sdf file: 766410.sdf
directory: 766410

139602-08-7 Ala-phe-ser-ser-trp-gly-NH2 Alanyl-phenylalanyl-seryl-seryl-tryptophyl-glycinamide Leukokinin I, 1-de-L-aspartic acid-2-de-L-proline-5-L-serine- Locustakinin Lomk peptide

pdb file: 766417.pdb
sdf file: 766417.sdf
directory: 766417

54799-93-8 Benzoyl-phe-val-arg-p-nitroanilide Bz-Phe-val-arg-paranitroanilide Bzphevalargnan L-Argininamide, N-benzoyl-L-phenylalanyl-L-valyl-N-(4-nitrophenyl)- N-Benzoyl-L-phenylalanyl-L-valyl-L-arginine-p-nitroanilide Nalpha-Benzoyl-L-phenylalanyl-L-valyl-L-arginine-p-nitroanilide S 2160 S-2160

pdb file: 766650.pdb
sdf file: 766650.sdf
directory: 766650

69201-89-4 Boc-D-phe-pro-arg-al Gyki 14,451 Gyki 14451 L-Prolinamide, N-((1,1-dimethylethoxy)carbonyl)-D-phenylalanyl-N-(4-((aminoiminomethyl)amino)-1-formylbutyl)-, (S)- LY 178207 tert-Butyl-oxy-carbonyl-D-phe-pro-arg-al tert-Butyloxycarbonyl-phenylalanyl-prolyl-arginal

pdb file: 767250.pdb
sdf file: 767250.sdf
directory: 767250

72252-90-5 Methoxy-suc-ala-ala-pro-val-7-amino-4-methylcoumarin Methoxy-succinyl-alanyl-alanyl-prolyl-valine-7-amino-4-methylcoumarin Msaapvamc

pdb file: 767279.pdb
sdf file: 767279.sdf
directory: 767279

160275-36-5 161247-62-7 Betabellin 14 Betabellin 14D Betabellin 14S L-Glutamic acid, L-histidyl-L-seryl-L-leucyl-L-threonyl-L-alanyl-L-seryl-L-isoleucyl-D-lysyl-D-alanyl-L-leucyl-L-threonyl-L-isoleucyl-L-histidyl-L-valyl-L-glutaminyl-D-alanyl-D-lysyl-L-threonyl-L-alanyl-L-threonyl-L-cysteinyl-L-glutaminyl-L-valyl-D-lysyl-D-alanyl-L-tyrosyl-L-threonyl-L-valyl-L-histidyl-L-isoleucyl-L-seryl-, bimol (21-21')-disulfide

pdb file: 767281.pdb
sdf file: 767281.sdf
directory: 767281

73617-93-3 Arylazido-beta-alanyl-NADPH Arylazido-beta-alanyl-nadp Arylazido-beta-alanyl-nadp(+) N-(3'-O-(3-(N-Azido-2-nitrophenyl)amino)propionyl)nadp beta-Alanine, N- (4-azido-2-nitrophenyl)-, 2'-ester with adenosine 5'-(trihydrogen diphosphate) 2'-(dihydrogen phosphate) 5'-5'-ester with 3-(aminocarbonyl)-1-beta-D-ribofuranosylpyridinium hydroxide inner salt

pdb file: 767299.pdb
sdf file: 767299.sdf
directory: 767299

75873-86-8 Benzyloxycarbonyl-alanyl-leucyl-arginine-2-naphthylamide Benzyloxycarbonylalanyl-leucyl-arginine-2-naphthylamide L-Argininamide, N-((phenylmethoxy)carbonyl)-D-alanyl-L-leucyl-N-2-naphthalenyl- Z-Ala-leu-arg-2-naphthylamide

pdb file: 767347.pdb
sdf file: 767347.sdf
directory: 767347

6-Lys-met-enkephalin 6-Lysine-5-methionine-enkephalin 75909-25-0 Enkephalin-met, lys(6)- Enkephalin-met, lysine(6)- L-Lysine, N2-(N-(N-(N-(N-L-tyrosylglycyl)glycyl)-L-phenylalanyl)-L-methionyl)- Met-enk-L Met-enkephalin, lys(6)- Methionine-enkephalin, lys(6)-

pdb file: 767349.pdb
sdf file: 767349.sdf
directory: 767349

76080-70-1 Cgp 15425 Cgp-15425 Cyclo(GABA-5-asn-6,7-phe-8-trp-9-lys-10-thr-11-phe)-somatostatin Cyclo(GABA-5-asparaginyl-6,7-phenylalanyl-8-tryptophyl-9-lysyl-10-threonyl-11-phenylalanine)-somatostatin L-Phenylalanine, N2-(4-amino-1-oxobutyl)-L-asparaginyl-L-phenylalanyl-L-phenylalanyl-D-tryptophyl-L-lysyl-L-threonyl-, cyclic (7-1)-peptide Somatostatin, cyclo(GABA-asn(5)-phe(6,7)-trp(8)-lys(9)-thr(10)-phe(11))- Somatostatin, cyclo(GABA-asparaginyl(5)-phenylalanyl(6,7)-tryptophyl(8)-lysyl(9)-threonyl(10)-phenylalanine(11))- Srih-cyclic-gaptltp

pdb file: 767352.pdb
sdf file: 767352.sdf
directory: 767352

76157-63-6 Ac-Phe-lys-CH2Cl Acetyl-phe-lys-chloromethyl ketone Acetylphenyl-alanyl-lysine chloromethyl ketone Benzenepropanamide, alpha-(acetylamino)-N-(5-amino-1-(chloroacetyl)pentyl)-, (S-(R*,R*))-

pdb file: 767354.pdb
sdf file: 767354.sdf
directory: 767354

147861-76-5 CGS 24128 Cgs-24128 N-(2-(Phosphonomethylamino)-3-(4-biphenylyl)propionyl)-3-aminopropionic acid beta-Alanine, N-(3-(1,1'-biphenyl)-4-yl-N-(phosphonomethyl)alanyl)-

pdb file: 767358.pdb
sdf file: 767358.sdf
directory: 767358

155919-39-4 H-Tyr-c(D-orn-2-nal-D-pro-gly-) Tyr-c(orn-2-nal-pro-gly-) Tyrosyl-cyclo(ornithyl-(2-naphthyl)alanyl-prolyl-glycyl-)

pdb file: 768349.pdb
sdf file: 768349.sdf
directory: 768349

156125-05-2 Peptide 82-205 Tagmpgni Tyr-D-ala-gly-Me-phe-gly-NH-C3H7-iso Tyrosyl-alanyl-glycyl-(methyl)phenylalanyl-glycine-(N-isopropyl)amide

pdb file: 768351.pdb
sdf file: 768351.sdf
directory: 768351

157135-53-0 Boc-ala-pro-phe-HO-Bz N-((tert-Butoxycarbonyl)alanyl-prolyl-phenylalanyl)-O-benzoylhydroxylamine

pdb file: 768395.pdb
sdf file: 768395.sdf
directory: 768395

157203-83-3 Ala-met-gly-leu-arg-met-NH2 Alanyl-methionyl-glycyl-leucyl-arginyl-methioninamide Pev-myomodulin

pdb file: 768398.pdb
sdf file: 768398.sdf
directory: 768398

157610-41-8 Bz-K(Nbd)-awfpp-nle-NH2 Bz-Lys(nbd)-ala-trp-phe-pro-pro-nle-NH2 N-alpha-Benzoyl-(epsilon-(7-nitrobenz-2-oxa-1,3-diazol-4-yl))lysyl-alanyl-tryptophyl-phenylalanyl-prolyl-prolyl-norleucinamide Nalpha-Benzoyl-lys(epsilon-nbd)-ala-D-trp-phe-D-pro-pro-nle-NH2

pdb file: 768409.pdb
sdf file: 768409.sdf
directory: 768409

157610-44-1 Bz-Orn(nbd)-ala-trp-phe-pro-pro-nle-NH2 Bz-Orn(nbd)-awfpp-nle-NH2 N-alpha-Benzoyl-(delta-(7-nitrobenz-2-oxa-1,3-diazol-4-yl))ornithinyl-alanyl-tryptophyl-phenylalanyl-prolyl-prolyl-norleucinamide Nalpha-Benzoyl-orn(delta-nbd)-ala-D-trp-phe-D-pro-pro-nle-NH2

pdb file: 768410.pdb
sdf file: 768410.sdf
directory: 768410

1,2-Dehydro-N-beta-alanyldopamine 1,2-Dehydro-nbad 158018-58-7

pdb file: 768429.pdb
sdf file: 768429.sdf
directory: 768429

(Hyp(3))met-callatostatin 158641-27-1 Gly-pro-hyp-tyr-asp-phe-gly-met-NH2 Glycyl-prolyl-hydroxyprolyl-tyrosyl-aspartyl-phenylalanyl-glycyl-methioninamide

pdb file: 768450.pdb
sdf file: 768450.sdf
directory: 768450

159698-59-6 N-((1,1-Dimethylethoxy)carbonyl)-L-phenylalanyl-N-(7-((aminocarbonyl)amino)heptyl)methyl-D-phenylalaninamide PD 157672 PD-157672

pdb file: 768471.pdb
sdf file: 768471.sdf
directory: 768471

161258-31-7 2-Coumaroylphenylalanyl-alanyl-arginine Cum-phe-ala-arg Cum-phe-ala-arg-OH o-Coumaroylphenylalanyl-alanyl-arginine

pdb file: 768485.pdb
sdf file: 768485.sdf
directory: 768485

38510-47-3 L-Proline, 1-(N-(O-(1,1-dimethylethyl)-L-threonyl)-L-phenylalanyl)- Thr-(O-tert butyl)-phe-pro-OH Threonyl-(O-tert-butyl)-phenylalanyl-proline

pdb file: 768498.pdb
sdf file: 768498.sdf
directory: 768498

43210-80-6 Glycine, N-(N-(N2-(N-(N-(N2-L-methionyl-L-arginyl)-L-histidyl)-L-phenylalanyl)-L-arginyl)-L-tryptophyl)- Met-arg-his-phe-arg-trp-gly Methionyl-arginyl-histidyl-phenylalanyl-tryptophyl-glycine

pdb file: 768615.pdb
sdf file: 768615.sdf
directory: 768615

52250-44-9 Adenosine, cytidylyl-(3'-5')-, 2'(or 3')-ester with L-phenylalanine Cytidylyl-3'-5'-(2'(3')-O-L-phenylalanyl)-L-adenosine

pdb file: 768733.pdb
sdf file: 768733.sdf
directory: 768733

52780-81-1 L-Alaninamide, L-phenylalanyl-N-(5-amino-1-(chloroacetyl)pentyl)-, (S)- Phe-ala-lys-chloromethyl ketone Phenylalanyl-alanyl-lysine chloromethyl ketone

pdb file: 768756.pdb
sdf file: 768756.sdf
directory: 768756

1-Sar-7-ala-8-N-Me-phe-angiotensin II 1-Sarcosyl-7-alanyl-8-N-methylphenylalanine angiotensine II 53954-37-3 Angiotensin II, 1-(N-methylglycine)-5-L-valine-7-L-alanine-8-(N-methyl-L-phenylalanine)- Angiotensin II, sar(1)-ala(7)-N-Me-phe(8)- Angiotensin II, sarcosyl(1)-alanyl(7)-N-methylphenylalanine(8)- Samp-angiotensin II

pdb file: 768791.pdb
sdf file: 768791.sdf
directory: 768791

(S)-Ala-3-(alpha-(S)-chloro-3-(S)-hydroxy-2-oxo-3-azetidinylmethyl)-(S)-ala (S)-Alanyl-3-(alpha-(S)-chloro-3-(S)-hydroxy-2-oxo-3-azetidinylmethyl)-(S)-alanine 54922-56-4 Butanoic acid, L-alanyl-gamma-chloro-gamma-(3-hydroxy-2-oxo-3-azetidinyl)-L-alpha-amino-, (S-(R*,R*))-

pdb file: 768829.pdb
sdf file: 768829.sdf
directory: 768829

55207-84-6 Hgh 1-15 Human growth hormone 1-15 L-Leucine, L-phenylalanyl-L-prolyl-L-threonyl-L-isoleucyl-L-prolyl-L-leucyl-L-seryl-L-arginyl-L-leucyl-L-phenylalanyl-L-alpha-aspartyl-L-asparaginyl-L-alanyl-L-methionyl-

pdb file: 768848.pdb
sdf file: 768848.sdf
directory: 768848

2-Des-his-6-ala-9-N-Et-pronh2-10-des-glynh2-LHRH 2-de-L-Histidine-6-D-alanine-9-(N-ethyl-L-prolinamide)-10-deglycinamide luteinizing hormone releasing factor 56670-52-1 Dhadg-lhrhea GNRH, des-his(2)-ala(6)-N-Et-pronh2(9)- LHRH, Des-histidyl(2)-alanyl(6)-N-Et-prolinamide(9)-des-glycinamide(10)- LHRH, des-his(2)-ala(6)-N-Et-pronh2(9)-

pdb file: 768898.pdb
sdf file: 768898.sdf
directory: 768898

57449-34-0 Benzenepropanamide, alpha-(acetylamino)-N-(1-(hydroxymethyl)-2-phenylethyl)-, (S-(R*,R*))- N-Acetyl-L-phenylalanyl-L-phenylalanine alcohol N-Acetyl-phe-phe alcohol N-Acetylphenylalanylphenylalanine alcohol

pdb file: 768924.pdb
sdf file: 768924.sdf
directory: 768924

57851-61-3 DP 432 DP-432 L-Tyrosinamide, beta-alanyl-L-arginylglycyl-L-phenylalanyl-L-phenylalanyl- beta-Alanyl-Arg-Gly-Phe-Phe-Tyr-NH2 beta-Alanyl-L-arginylglycyl-L-phenylalanyl-L-phenylalanyl-L-tyrosinamide

pdb file: 768939.pdb
sdf file: 768939.sdf
directory: 768939

57997-72-5 Glycine, L-phenylalanyl-L-seryl-L-tryptophyl-L-glutaminyl-L-lysyl-L-phenylalanyl-L-seryl-L-tryptophyl-L-glutaminyl-L-lysyl-L-phenylalanyl-L-seryl-L-tryptophyl-L-glutaminyl-L-lysyl-L-phenylalanyl-L-seryl-L-tryptophyl-L-glutaminyl-L-lysyl- Peptide S 42

pdb file: 768940.pdb
sdf file: 768940.sdf
directory: 768940

60355-79-5 D-Glutamic acid, N-(N-(N-acetylmuramoyl)-L-alanyl)-, dimethyl ester Dimethyl-N-acetylmuramyl-L-alanyl-D-glutamate Dimethyl-N-acetylmuramyl-alanylglutamate Dimethyl-N-acmu-ala-glu N-Acetylmuramyl-L-alanyl-D-glutamic acid dimethyl ester

pdb file: 769013.pdb
sdf file: 769013.sdf
directory: 769013

1,2-Bi-(adenosine-N(6)-yl)ethane-2'(3')-O-L-phenylalanyl derivative 64542-52-5 L-Phenylalanine, 2'(or 3')-ester with N,N'-1,2-ethanediylbis(adenosine)

pdb file: 769170.pdb
sdf file: 769170.sdf
directory: 769170

65848-04-6 Ala-phosphatidylglycerol Alanylphosphatidylglycerol L-Alanine, 2,5-dihydroxy-11-oxo-8-((1-oxododecyl)oxy)-4,6,10-trioxa-5-phosphadocos-1-yl ester, P-oxide, (R-(R*,R*))-

pdb file: 769207.pdb
sdf file: 769207.sdf
directory: 769207

2'(3')-O-(N-Acetyl)-L-leucyl-2'(3')-O-L-phenylalanyl-(1,2-diadenosin-N(6)-yl)ethane 67462-03-7 L-Phenylalanine, 2'(or 3')-ester with N-(2-((9-(2'(or 3')-O-(2-(acetylamino)-4-methyl-1-oxopentyl)-beta-D-ribofuranosyl)-9H-purin-6-yl)amino)ethyl)adenosine

pdb file: 769271.pdb
sdf file: 769271.sdf
directory: 769271

68762-71-0 Acetyldehydro-3-(2-furyl)-ala-tyr Acetyldehydro-3-(2-furyl)alanyltyrosine L-Tyrosine, N-(N-acetyl-2,3-didehydro-3-(2-furanyl)alanyl)-

pdb file: 769307.pdb
sdf file: 769307.sdf
directory: 769307

2-Ala-4-didehydro-phe-met-enkephalinamide 69181-23-3 Enk-madhp Enkephalinamide-met, ala(2)-didehydro-phe(4)- Enkephalinamide-met, alanyl(2)-didehydrophenylalanine(4)- L-Methioninamide, L-tyrosyl-D-alanylglycyl-(Z)-alpha,beta-didehydrophenylalanyl- Met-enkephalinamide, ala(2)-didehydro-phe(4)- Methionine-enkephalinamide, ala(2)-didehydro-phe(4)-

pdb file: 769315.pdb
sdf file: 769315.sdf
directory: 769315

69935-29-1 L-Leucine, N-(N-((Z)-alpha,beta-didehydro-N-(1-((phenylmethoxy)carbonyl)-L-prolyl)phenylalanyl)-L-histidyl)- N-Benzyloxycarbonyl-L-prolyldehydrophenylalanyl-L-histidyl-L-leucine N-Benzyloxycarbonyl-pro-dehydro-phe-his-leu N-Benzyloxycarbonylprolyl-dehydrophenylalanyl-histidyl-leucine Z-Pro-dehydro-phe-his-leu

pdb file: 769340.pdb
sdf file: 769340.sdf
directory: 769340

71448-11-8 Benzoyl-ala-arg Benzoylalanylarginine L-Arginine, N(2)-(N-benzoyl-L-alanyl)-

pdb file: 769387.pdb
sdf file: 769387.sdf
directory: 769387

(3-(1,4-Cyclohexadienyl)-L-alanine,8-lysine)vasopressin (3-(1,4-Cyclohexadienyl)ala-8-lys)vasopressin (3-(1,4-Cyclohexadienyl)alanyl-8-lysine)vasopressin (3-(2,5-Dihydrophenylalanine),8-lysine)vasopressin 71753-39-4 Vasopressin, (3-(1,4-cyclohexadienyl)ala-8-lys)- Vasopressin, (3-(1,4-cyclohexadienyl)alanyl-8-lysine)- Vasopressin, 3-(3-(1,4-cyclohexadien-1-yl)-L-alanine)-8-L-lysine-

pdb file: 769398.pdb
sdf file: 769398.sdf
directory: 769398

1-Deaminopenicillamine-2-phe-oxytocin 72915-15-2 OXAPP Oxytocin, 1-(3-mercapto-3-methylbutanoic acid)-2-L-phenylalanine- Oxytocin, 1-desaminopenicillamyl-phe(2)- Oxytocin, 1-desaminopenicillamyl-phenylalanyl(2)-

pdb file: 769435.pdb
sdf file: 769435.sdf
directory: 769435

1-Deaminopenicillamine-2-phe-4-thr-oxytocin 72930-66-6 Oxappt Oxytocin, 1-(3-mercapto-3-methylbutanoic acid)-2-L-phenylalanine-4-L-threonine- Oxytocin, 1-deaminopenicillamyl-phe(2)-thr(4)- Oxytocin, 1-deaminopenicillamyl-phenylalanyl(2)-threonine(4)-

pdb file: 769436.pdb
sdf file: 769436.sdf
directory: 769436

73392-20-8 Ac-Phe-gly-al Acetylphenylalanylglycinal

pdb file: 769443.pdb
sdf file: 769443.sdf
directory: 769443

76626-36-3 H-D-Val-phe-lys-p-nitroanilide H-D-Valyl-L-phenylalanyl-L-lysine-p-nitroanilide dihydrochloride L-Lysinamide, D-valyl-L-phenylalanyl-N-(4-nitrophenyl)- S 2390 S-2390 Val-phe-lys-pna Valyl-phenylalanyl-lysine-4-nitroanilide

pdb file: 769495.pdb
sdf file: 769495.sdf
directory: 769495

88463-10-9 Benzyloxycarbonyl-phenylalanyl-dehydrophenylalanine Z-Phe-(Z)-deltaphe

pdb file: 769608.pdb
sdf file: 769608.sdf
directory: 769608

89315-28-6 Kemptamide L-Serinamide, L-lysyl-L-lysyl-L-arginyl-L-prolyl-L-glutaminyl-L-arginyl-L-alanyl-L-threonyl-L-seryl-L-asparaginyl-L-valyl-L-phenylalanyl-

pdb file: 769613.pdb
sdf file: 769613.sdf
directory: 769613

90332-96-0 Z-Phe-arg-4-methoxy-beta-naphthylamide Zpambn alpha-N-Benzyloxycarbonyl-phe-arg-4-methoxy-beta-naphthylamide alpha-N-Benzyloxycarbonyl-phenylalanyl-arginyl-4-methoxy-beta-naphthylamide

pdb file: 769615.pdb
sdf file: 769615.sdf
directory: 769615

92662-82-3 Ol-Ala-ala-pro-val Ol-Ala-ala-pro-val-OH Oleoylalanyl-alanyl-prolyl-valine

pdb file: 769620.pdb
sdf file: 769620.sdf
directory: 769620

94664-48-9 Ehfrwgkpvg-NH2 Glu-his-phe-arg-trp-gly-lys-pro-val-gly-NH2 cyclic peptide Glutamyl-histidyl-phenylalanyl-arginyl-tryptophyl-glycyl-lysyl-prolyl-valyl-glycinamide cyclic peptide

pdb file: 769627.pdb
sdf file: 769627.sdf
directory: 769627

97590-10-8 Maap-borof Meosuc-ala-ala-pro-borophe O-Methylsuccinyl-alanyl-alanyl-prolyl-borophenylalanine

pdb file: 769631.pdb
sdf file: 769631.sdf
directory: 769631

99781-72-3 Cyclo(GP-p(CH2S)-gfp) Cyclo(gly-pro-psi(CH2S)-gly-phe-pro) Cyclo(glycyl-prolyl-psi(CH2S)-glycyl-phenylalanyl-prolyl)

pdb file: 769642.pdb
sdf file: 769642.sdf
directory: 769642

135216-07-8 N-Ac-2-Nal-4-clphe-3-pal-ser-nmetyr-lys-leu-lys-pro-alanh2 N-Acetyl-2-naphthylalanyl-4-chlorophenyalanyl-3-pyridylalanyl-seryl-N-methyltyrosyl-lysyl-leucyl-lysyl-prolyl-alaninamide Nappsmlllpa

pdb file: 769648.pdb
sdf file: 769648.sdf
directory: 769648

136037-37-1 H-Tyr-c(D-orn-phe-D-pro-gly-) Tyr-c(orn-phe-pro-gly-) Tyrosyl-cyclo(ornithyl-phenylalanyl-prolyl-glycyl-)

pdb file: 769655.pdb
sdf file: 769655.sdf
directory: 769655

140939-04-4 4-Decenoyl-gly-gly-leu-aib-gly-leu-lol 4-Decenoyl-glycyl-glycyl-leucyl-2-methylalanyl-glycyl-leucyl-leucinol L-Leucinamide, N-(1-oxo-4-decenyl)glycylglycyl-L-leucyl-2-aminobutanoylglycyl-N-(1-(hydroxymethyl)-3-methylbutyl)-, (1(Z),6(S))- Trichodecenin II Trichodecenin-II

pdb file: 769688.pdb
sdf file: 769688.sdf
directory: 769688

(1,1-Dimethylethoxy)carbonyl-tyrosyl-prolyl-glycyl-phenylalanyl-leucyl-threonine 141261-96-3 Boc-tyr-pro-gly-phe-leu-thr

pdb file: 769691.pdb
sdf file: 769691.sdf
directory: 769691

(1,1-Dimethylethoxy)carbonyl-glycyl-delta-phenylalanyl-leucyl-delta-phenylalanyl-N-methylalaninamide 141695-65-0 Boc-gdfldfa-nhme Boc-gly-delta-phe-leu-delta-phe-ala-nhch3

pdb file: 769697.pdb
sdf file: 769697.sdf
directory: 769697

144334-53-2 3-Phe-4-asn-8-val-oxytocin Oxytocin, phe(3)-asn(4)-val(8)- Oxytocin, phenylalanyl(3)-asparaginyl(4)-valyl(8)- Phasvatocin Vasopressin, 4-L-asparagine-8-L-valine-

pdb file: 769719.pdb
sdf file: 769719.sdf
directory: 769719

147138-51-0 Galanin(1-12)-ala-neuropeptide Y(25-36)amide Galanin(1-12)-alanyl-neuropeptide Y(25-36)amide M 88 Peptide M88 Peptide Neuropeptide Y(25-36)amide, galanin(1-12)-ala-

pdb file: 769754.pdb
sdf file: 769754.sdf
directory: 769754

148138-57-2 Cyclo(gly-pro-psi(CH2NH)-gly-phe-pro) Cyclo(glycyl-prolyl-psi(CH2NH)-glycyl-phenylalanyl-prolyl) Cyclo(gppgfp)-tfa

pdb file: 769774.pdb
sdf file: 769774.sdf
directory: 769774

148337-06-8 Pgaipg Pro-gly-ala-ile-pro-gly Prolyl-glycyl-alanyl-isoleucyl-prolyl-glycine

pdb file: 769779.pdb
sdf file: 769779.sdf
directory: 769779

148383-07-7 Ser-phe-oic-arg Seryl-phenylalanyl-octahydroindole-2-carbonyl-arginine

pdb file: 769781.pdb
sdf file: 769781.sdf
directory: 769781

148619-41-4 Cyclo(-OH-leu-ile-(nme)ala-(nme)leu-leu-(nme)ala-(nme)ala-) Cyclo(OH-leucyl-isoleucyl-(N-methyl)alanyl-(N-methyl)leucyl-leucyl-(N-methyl)alanyl-(N-methyl)alanyl-) Ternatin heptapeptide

pdb file: 769790.pdb
sdf file: 769790.sdf
directory: 769790

148750-86-1 t-Boc-ala-gly-monohydrate tert-Butyloxycarbonyl-L-alanylglycine monohydrate tert-Butyloxycarbonyl-alanyl-glycine

pdb file: 769797.pdb
sdf file: 769797.sdf
directory: 769797

148914-46-9 N-Boc-L-phe-dehydro-abu-NH-CH3 N-Bpda N-Butyloxycarbonyl-phenylalanyl-dehydroaminobutyryl-NH-CH3

pdb file: 769803.pdb
sdf file: 769803.sdf
directory: 769803

149097-03-0 H-Leu-arg-gln-ser-gln-phe-val-gly-ser-arg-NH2 Leucyl-arginyl-glutaminyl-seryl-glutaminyl-phenylalanyl-valyl-glycyl-seryl-argininamide Urechistachykinin I

pdb file: 769814.pdb
sdf file: 769814.sdf
directory: 769814

149097-04-1 Alanyl-alanyl-glycyl-methionyl-glycyl-phenylalanyl-phenylalanyl-glycyl-alanyl-argininamide H-Ala-ala-gly-met-gly-phe-phe-gly-ala-arg-NH2 Urechistachykinin II

pdb file: 769815.pdb
sdf file: 769815.sdf
directory: 769815

(Cbz-ala4)2-rhodamine 149695-85-2 Bis(N-benzyloxycarbonyl-L-tetraalanyl)rhodamine Bis(N-benzyloxycarbonyltetraalanyl)rhodamine Bzt-ala-R

pdb file: 769832.pdb
sdf file: 769832.sdf
directory: 769832

150529-59-2 Boc-A-dF-dF-nhme Boc-ala-dehydro-phe-dehydro-phe-nhme Boc-ala-delta-phe-delta-phe-nhme tert-Butyloxycarbonylalanyl-dehydrophenylalanyl-(N-methyl)dehydrophenylalaninamide

pdb file: 769853.pdb
sdf file: 769853.sdf
directory: 769853

150942-61-3 Ser-leu-ser-arg-tyr-ala-lys-leu-ala-asn-arg-leu-ala Seryl-leucyl-seryl-arginyl-tyrosyl-alanyl-lysyl-leucyl-alanyl-asparaginyl-arginyl-leucyl-alanine Slsryaklanrla

pdb file: 769868.pdb
sdf file: 769868.sdf
directory: 769868

151545-20-9 Cyclic (prolyl-alanyl-D-phenylalanyl-leucyl) Cyclo pafl Cyclo(pro-ala-phe-leu) Cyclo(prolyl-alanyl-phenylalanyl-leucyl)

pdb file: 769908.pdb
sdf file: 769908.sdf
directory: 769908

(Ala(3))dpdpe 151608-23-0 2,5-Pen-3-ala-enkephalin Enkephalin, pen(2,5)-ala(3)- Enkephalin, penicillamine(2,5)-alanyl(3)-

pdb file: 769911.pdb
sdf file: 769911.sdf
directory: 769911

151629-29-7 Boc-phe-D-leu-thr-ome tert-Butyloxycarbonyl phenylalanyl-leucyl-threonine methyl ester

pdb file: 769912.pdb
sdf file: 769912.sdf
directory: 769912

151812-20-3 Locustapyrokinin II Pglu-ser-val-pro-thr-phe-thr-pro-arg-leu-NH2 Pyroglutamyl-seryl-valyl-prolyl-threonyl-phenylalanyl-threonyl-prolyl-arginyl-leucinamide

pdb file: 769922.pdb
sdf file: 769922.sdf
directory: 769922

151937-05-2 Asfry-NH2 Asn-ser-phe-arg-tyr-NH2 Asparaginyl-seryl-phenylalanyl-arginyl-tyrosinamide

pdb file: 769931.pdb
sdf file: 769931.sdf
directory: 769931

152551-55-8 Benzyloxycarbonyl-ala-ala-pro-phe-trifluoromethylketone Benzyloxycarbonyl-alanyl-alanyl-prolyl-phenylalanine-trifluoromethylketone Carbobenzoxy-ala-ala-pro-phe-trifluoromethylketone Z-Ala-ala-pro-phe-trifluoromethylketone Zaapf-tfmk

pdb file: 769958.pdb
sdf file: 769958.sdf
directory: 769958

152846-72-5 Cpd-II Culekinin depolarizing peptide II Glycinamide, L-asparaginyl-L-asparaginyl-L-alanyl-L-asparaginyl-L-valyl-L-phenylalanyl-L-tyrosyl-L-prolyl-L-tryptophyl-

pdb file: 769980.pdb
sdf file: 769980.sdf
directory: 769980

153824-53-4 F-Cyc(clfc)ome For-cyclo(cys-leu-phe-cys)ome Formyl-cyclo(cysteinyl-leucyl-phenylalanyl-cysteinyl) methyl ester

pdb file: 770016.pdb
sdf file: 770016.sdf
directory: 770016

178823-49-9 L-Proline, D-alanyl-L-lysyl-L-prolyl-L-valyl-L-valyl-L-histidyl-L-leucyl-L-phenylalanyl-L-alanyl-L-asparaginyl-L-isoleucyl-L-valyl-L-threonyl-L-prolyl-L-arginyl-L-threonyl- NBI 5788 NBI5788 Tiplimotide Tiplimotide [INN]

pdb file: 770069.pdb
sdf file: 770069.sdf
directory: 770069

140158-49-2 HCNP Hippocampal cholinergic neurostimulating peptide L-Leucine, N-(1-(N-(N-(N-(N2-(N-(N-(N-(N-(N-acetyl-L-alanyl)-L-alanyl)-L-alpha-aspartyl)-L-isoleucyl)-L-seryl)-L-glutaminyl)-L-tryptophyl)-L-alanyl)glycyl)-L-prolyl)-

pdb file: 770077.pdb
sdf file: 770077.sdf
directory: 770077

(gamma-L-Glutamyl-L-selenocysteinylglycine)diselenide 2487-09-4 Glutaselenone diselenide Glycine, 2,2'-diselenobis(L-gamma-glutamyl-L-alanyl- N,N'-(Diselenobis(1-((carboxymethyl)carbamoyl)ethylene))diglutamine

pdb file: 770131.pdb
sdf file: 770131.sdf
directory: 770131

14287-21-9 L-Lysine, N2-(N-acetyl-L-phenylalanyl)- N-Acetyl-phe-lys N-Acetylphenylalanyllysine

pdb file: 770279.pdb
sdf file: 770279.sdf
directory: 770279

36199-70-9 N-Acetyldehydro-phe-pro diketopiperazine N-Acetyldehydrophenylalanyl-L-proline diketopiperazine N-Acetyldehydrophenylalanylproline diketopiperazine Pyrrolo(1,2-a)pyrazine-1,4-dione, 2-acetylhexahydro-3-(phenylmethylene)-

pdb file: 770583.pdb
sdf file: 770583.sdf
directory: 770583

38320-48-8 L-Alaninamide, N-acetyl-L-alanyl-N-(3-chloro-1-methyl-2-oxopropyl)-, (S)- N-Acetyl-ala-ala-ala-chloromethyl ketone N-Acetylalanyl-alanyl-alanine chloromethyl ketone

pdb file: 770629.pdb
sdf file: 770629.sdf
directory: 770629

57241-86-8 ACTH - (7-16)-amide Acth (7-16)NH2 L-Lysinamide, L-phenylalanyl-L-arginyl-L-tryptophylglycyl-L-lysyl-L-prolyl-L-valylglycyl-L-lysyl-

pdb file: 771381.pdb
sdf file: 771381.sdf
directory: 771381

59275-09-1 Acmu-L-ala-D-iso-gln-lys Amaigl L-Lysine, N2-(N2-(N-(N-acetylmuramoyl)-L-alanyl)-D-alpha-glutaminyl)- N-Acetylmuramyl-alanyl-isoglutaminyl-lysine

pdb file: 771430.pdb
sdf file: 771430.sdf
directory: 771430

60117-19-3 L-Methionine, N-(N-(N-(N-(N-L-arginyl-L-tyrosyl)glycyl)glycyl)-L-phenylalanyl)-, (6R-(6alpha,7alpha,7(R*)))- beta-Lipotropin (60-65) beta-Lph(60-65)

pdb file: 771451.pdb
sdf file: 771451.sdf
directory: 771451

62995-90-8 Beauverolide H Beauverolide I Beauverolides Cyclo-((r)-beta-hydroxynonanoyl-L-phenylalanyl-alanyl-D-leucyl) D-Leucine, N-(N-(N-(3-hydroxy-1-oxononyl)-L-phenylalanyl)-L-alanyl)-, lambda-lactone, (R)-

pdb file: 771505.pdb
sdf file: 771505.sdf
directory: 771505

63555-63-5 C 3a Octapeptide C 3a-Octapeptide C3a(70-77) Complement 3a (70-77) Complement 3a octapeptide L-Arginine, N2-(N-(N-(N-(N-(N-(N-L-alanyl-L-seryl)-L-histidyl)-L-leucyl)glycyl)-L-leucyl)-L-alanyl)-

pdb file: 771514.pdb
sdf file: 771514.sdf
directory: 771514

2-Met-5-pro-enkephalin 64267-98-7 Enkephalin, met(2)-pro(5)- Enkephalin, methionyl(2)-proline(5)- L-Proline, 1-(N-(N-(N-L-tyrosyl-D-methionyl)glycyl)-L-phenylalanyl)-

pdb file: 771534.pdb
sdf file: 771534.sdf
directory: 771534

64295-19-8 Alanine, N-(N-(N-(1-((1,1-dimethylethoxy)carbonyl)-L-prolyl)-2-methylalanyl)-L-alanyl)-2-methyl-, methyl ester Boc-pro-aib-ala-aib-ome tert-Butyloxycarbonyl-prolyl-2-aminoisobutyryl-alanyl-2-aminoisobutyrate methyl ester

pdb file: 771536.pdb
sdf file: 771536.sdf
directory: 771536

64717-18-6 L-Serine, L-leucyl-L-glutaminyl-L-alpha-aspartyl-L-valyl-L-histidyl-L-asparaginyl-L-phenylalanyl-L-valyl-L-alanyl-L-leucylglycyl-L-alanyl-L-seryl-L-isoleucyl-L-alanyl-L-tyrosyl-L-arginyl-L-alpha-aspartylglycyl-L-seryl- Parathyroid hormone (24-48) Pth (24-48)

pdb file: 771544.pdb
sdf file: 771544.sdf
directory: 771544

66277-14-3 Aahnma Asp-ala-his-N-methylamide Aspartyl-alanyl-histidine-N-methylamide L-Aspartyl-L-alanyl-histidine-N-methylamide L-Histidinamide, L-alpha-aspartyl-L-alanyl-N-methyl-

pdb file: 771575.pdb
sdf file: 771575.sdf
directory: 771575

67224-41-3 Acth (4-11) Acth 4-11 Corticotropin 4-11 L-Lysine, N2-(N-(N-(N2-(N-(N-(N-L-methionyl-L-alpha-glutamyl)-L-histidyl)-L-phenylalanyl)-L-arginyl)-L-tryptophyl)glycyl)-

pdb file: 771595.pdb
sdf file: 771595.sdf
directory: 771595

2-Ala-5-N-Et-leu-enkephalinamide 67787-85-3 BW 831C BW-831C Enkephalinamide-leu, ala(2)-N-Et(5)- L-Tyrosyl-D-alanylglycyl-L-phenylalanyl-N-ethyl-D-leucinamide Leu-enkephalinamide, ala(2)-N-Et(5)- Tyr-ala-gly-phe-N-Et-leu Tyrosyl-alanylglycyl-phenylalanyl-N-ethyl-leucinamide

pdb file: 771613.pdb
sdf file: 771613.sdf
directory: 771613

2-Ala-4-(penta-F-phe)-met-enkephalinamide 67875-58-5 Afpm-enkephalinamide Enkephalinamide-met, ala(2)-(penta-F-phe)(4)- Enkephalinamide-met, alanyl(2)-pentafluorophenylalanine(4)- L-Methioninamide, L-tyrosyl-D-alanylglycyl-2,3,4,5,6-pentafluoro-L-phenylalanyl- Met-enkephalinamide-ala(2)-(penta-F-phe)(4)- Methionine-enkephalinamide, ala(2)-(penta-F-phe)(4)-

pdb file: 771614.pdb
sdf file: 771614.sdf
directory: 771614

68739-25-3 L-Alaninamide, N2-(trifluoroacetyl)-L-lysyl-N-(4-(trifluoromethyl)phenyl)- TFAI Tfa-lys-ala-tfmpa Trifluoroacetyl-lysyl-alanyl-trifluoromethylphenylanilide Trifluoroacetyllysylalanine-trifluoromethylphenylanilide

pdb file: 771632.pdb
sdf file: 771632.sdf
directory: 771632

69536-83-0 Ac-Phe-arg-oet L-Arginine, N2-(N-acetyl-L-phenylalanyl)-, ethyl ester N-Acetylphenylalanylarginine ethyl ester

pdb file: 771662.pdb
sdf file: 771662.sdf
directory: 771662

4-Toluenesulfonyl-penta(alpha-aminoisobutyryl)methyl ester 69555-87-9 Alanine, 2-methyl-N-(2-methyl-N-(2-methyl-N-(2-methyl-N-(2-methyl-N-((4-methylphenyl)sulfonyl)alanyl)alanyl)alanyl)alanyl)-, methyl ester TAOME Tosyl-(aib)(5)-ome p-Toluenesulfonyl-penta(alpha-aminoisobutyryl)methyl ester

pdb file: 771663.pdb
sdf file: 771663.sdf
directory: 771663

70475-39-7 GSOAN Glutathione sulfinanilide Glutathione sulphinanilide Glycine, N-(N-L-gamma-glutamyl-3-((phenylamino)sulfinyl)-L-alanyl)-

pdb file: 771684.pdb
sdf file: 771684.sdf
directory: 771684

70529-66-7 Acetyl-ala-tyr Acetylalanyltyrosine CH3CO-Ala-tyr L-Tyrosine, N-(N-acetyl-L-alanyl)-

pdb file: 771687.pdb
sdf file: 771687.sdf
directory: 771687

70706-82-0 Isovaleryl-L-valyl-L-valylstatyl-L-alanylstatyl-L-arginine methyl ester Pepstatin A, 5a-L-arginine-, methyl ester Pepstatin arginine methyl ester Pepstatinyl arginine methyl ester Pepstatyl-arg-ome Pepstatyl-arginine methyl ester

pdb file: 771698.pdb
sdf file: 771698.sdf
directory: 771698

70706-87-5 Glu-pepstatyl Iso-valeryl-valyl-valyl-statyl-ala-statyl-glu Isovaleryl-valyl-valylstatyl-alanyl-statyl-glutamic acid Pepstatin A, 5a-L-glutamic acid- Pepstatyl, glu- Pepstatyl, glutamic acid

pdb file: 771699.pdb
sdf file: 771699.sdf
directory: 771699

70706-88-6 Iso-valeryl-valyl-valylstatyl-ala-statyl-asp Iso-valeryl-valyl-valylstatyl-alanylstatyl-aspartic acid Pepstatin A, 5a-L-aspartic acid- Pepstatyl, asp- Pepstatyl, aspartic acid-

pdb file: 771700.pdb
sdf file: 771700.sdf
directory: 771700

2-Cys-5-cysnh2-enkephalin 70768-44-4 CCAE D-Cysteinamide, L-tyrosyl-D-cysteinylglycyl-L-phenylalanyl-, cyclic (2-5)-disulfide Enkephalin, cys(2)-cysnh2(5)- Enkephalin, cysteinyl(2)-cysteinamide(5)-

pdb file: 771701.pdb
sdf file: 771701.sdf
directory: 771701

2-Benzyl-3-mercaptopropanoyl-alanylglycinamide 71431-51-1 BMPAG Glycinamide, N-(2-(mercaptomethyl)-1-oxo-3-phenylpropyl)-L-alanyl-

pdb file: 771720.pdb
sdf file: 771720.sdf
directory: 771720

72007-47-7 Ala-pro-gly-(3-ile-5-val)-angiotensin II Angiotensin II, ala-pro-gly-(ile(3)-val(5))- Angiotensin II, alanyl-prolyl-glycyl-(isoleucyl(3)-valine(5))- Crinia-angiotensin L-Phenylalanine, N-(1-(N-(N-(N-(N-(N(2)-(N-(N-(1-L-alanyl-L-prolyl)glycyl)-L-alpha-aspartyl)-L-arginyl)-L-isoleucyl)-L-tyrosyl)-L-valyl)-L-histidyl)-L-prolyl)-

pdb file: 771760.pdb
sdf file: 771760.sdf
directory: 771760

72086-86-3 Baaaome Boc-ala-aib-ala-ome tert-Butyloxycarbonyl-alanyl-aminoisobutyryl-alanyl methyl ester

pdb file: 771762.pdb
sdf file: 771762.sdf
directory: 771762

72127-61-8 CHP1 Cyclic(L-lysyl-L-threonyl-L-phenylalanyl-L-phenylalanyl-L-phenylalanyl-D-tryptophyl), N-acetyl-S-(3-chloro-2-propenyl)-, (Z)- Cyclo(phe-phe-trp-lys-thr-phe) Cyclo(phenylalanyl-phenylalanyl-tryptophyl-lysyl-threonyl-phenylalanyl) Somatostatin, cyclic hexapeptide(phe-phe-trp-lys-thr-phe)- Somatostatin, cyclic hexapeptide(phenylalanyl-phenylalanyl-tryptophyl-lysyl-threonyl-phenylalanyl)-

pdb file: 771764.pdb
sdf file: 771764.sdf
directory: 771764

2-Ala-69-homo-arg-beta lph(61-19) 2-Alanyl-69-homoarginine-beta-lph(61-69) 72826-15-4 Aha-lph L-Lysine, N(6)-(aminoiminomethyl)-N(2)-(N-(N-(N-(N-(N-(N-(N-L-tyrosyl-D-alanyl)glycyl)-L-phenylalanyl)-L-methionyl)-L-threonyl)-L-seryl)-L-alpha-glutamyl)- Lph(61-69), 2-alanyl-69-homoarginine- beta-Lipotropin(61-69), 2-alanyl-69-homoarginine-

pdb file: 771806.pdb
sdf file: 771806.sdf
directory: 771806

(o-Nitrophenyl)sulphenyl pentagastrin (ortho-Nitrophenyl)sulfenyl pentagastrin 72957-43-8 L-Phenylalaninamide, N-((1,1-dimethylethoxy)carbonyl)-beta-alanyl-1-((2-nitrophenyl)thio)-L-tryptophyl-L-methionyl-L-alpha-aspartyl- PgNpS

pdb file: 771818.pdb
sdf file: 771818.sdf
directory: 771818

73142-64-0 L-Arginine, N2-(N-L-prolyl-L-phenylalanyl)-, 1-naphthalenyl ester Ppa-alpha-NE Pro-phe-arg-naphthyl ester Prolyl-phenylalanyl-arginine naphthylester

pdb file: 771829.pdb
sdf file: 771829.sdf
directory: 771829

73167-83-6 Hippuryl-phe-arg Hippuryl-phenylalanyl-arginine Hippurylphenylalanylarginine

pdb file: 771831.pdb
sdf file: 771831.sdf
directory: 771831

73488-89-8 N-Trifluoroacetyl-L-alanyl-L-phenylalaninal N-Trifluoroacetyl-ala-phe-aldehyde N-Trifluoroacetylalanylphenylalaninal Propanamide, N-(1-formyl-2-phenylethyl)-2-((trifluoroacetyl)amino)-, (S-(R*,R*))- Tfaapa

pdb file: 771850.pdb
sdf file: 771850.sdf
directory: 771850

108708-27-6 Carbamic acid, (2-(2-formyl-1-pyrrolidinyl)-1-methyl-2-oxoethyl)-, phenylmethyl ester N-Benzyloxycarbonyl-alanylprolinal N-Benzyloxycarbonylalanylprolinal Z-Ala-prolinal

pdb file: 772103.pdb
sdf file: 772103.sdf
directory: 772103

108906-59-8 N-Ac-Psp N-Acetylphenylalanyl-3-thiaphenylalanine

pdb file: 772108.pdb
sdf file: 772108.sdf
directory: 772108

1-N-Ac-3(2-Naphthyl)ala-2,3-phe-6-arg-7-phe-10-alanh2-LHRH 110014-25-0 GNRH, N-Ac-3(2-naphthyl)ala(1)-phe(2,3)-arg(6)-phe(7)-alanh2(10)- LHRH, N-Ac-3(2-Naphthyl)ala(1)-phe(2,3)-arg(6)-phe(7)-alanh2(10)- LHRH, N-Acetyl-3(2-naphthyl)alanyl(1)-phenylalanyl(7)-alaninamide(10)- LHRH-Anpapa

pdb file: 772150.pdb
sdf file: 772150.sdf
directory: 772150

1(beta-Mercapto(beta,beta-cyclopentamethylene)propionic acid)-2-phe(Me)-4-thr-8-orn-oxytocin 110220-69-4 Oxytocin, 1-(beta-mercapto-(beta,beta-cyclopentamethylene)propionic acid)-methylphenylalanyl(2)-threonyl(4)-ornthine(8)- Oxytocin, 1-(beta-mercapto-(beta,beta-cyclopentamethylene)propionic acid)-phe(Me)(2)-thr(4)-orn(8)- Ppto-OT

pdb file: 772156.pdb
sdf file: 772156.sdf
directory: 772156

110297-46-6 Avellanin B Cyclo(N-Me-phe-ala-val-2-aminobenzoyl-pro) Cyclo(alanylvalyl-2-aminobenzoylprolyl-N-methylphenylalanyl)

pdb file: 772160.pdb
sdf file: 772160.sdf
directory: 772160

110297-47-7 Avellanin A Cyclo(D-alanyl-L-isoleucyl-2-aminobenzoyl-L-prolyl-N-methyl-D-phenylalanyl) Cyclo(N-Me-phe-ala-ile-2-aminobenzoyl-pro)

pdb file: 772161.pdb
sdf file: 772161.sdf
directory: 772161

110590-39-1 Cyclo(gly-pro-D-phe-gly-val) Cyclo-(glycyl-prolyl-phenylalanyl-glycyl-valyl)

pdb file: 772174.pdb
sdf file: 772174.sdf
directory: 772174

111010-99-2 Cyclic-ptlt-3-ampa Cyclo(phe-trp-lys-thr-3-ampa) Cyclo-(phenylalanyl-tryptophyl-lysyl-threonyl-3-(aminomethyl)phenylacetic acid)

pdb file: 772186.pdb
sdf file: 772186.sdf
directory: 772186

111290-37-0 Eadlaa epsilon-N-Acetyl-alpha(N)-dansyl-lysyl-alanyl-alanine

pdb file: 772199.pdb
sdf file: 772199.sdf
directory: 772199

111394-11-7 Lys-arg-arg-trp-lys-lys-asp-phe-ile-ala-val Lysyl-arginyl-arginyl-tryptophyl-lysyl-lysyl-asparaginyl-phenylalanyl-isoleucyl-alanyl-valine SQ 31429 SQ-31429

pdb file: 772206.pdb
sdf file: 772206.sdf
directory: 772206

112227-15-3 Boc-phe-his-5-cyclohexylmethyl-4-hydroxy-2-isobutyl-5-aminopentanoyl-lys-phe CP 71362 CP-71362 L-Phenylalanine, N-(N2-(6-cyclohexyl-5-((N-(N-((1,1-dimethylethoxy)carbonyl)-L-phenylalanyl)-L-histidyl)amino)-4-hydroxy-2-(2-methylpropyl)-1-oxohexyl)-L-lysyl)-, (2R-(2R*,4S*,5S*))-

pdb file: 772249.pdb
sdf file: 772249.sdf
directory: 772249

112317-45-0 Hexapeptide 4 L-Phenylalanine, N-(N-(3-hydroxy-6-methyl-1-oxo-4-((N-(N-L-phenylalanylglycyl)-L-histidyl)amino)heptyl)-L-alanyl)-, methyl ester, (S-(R*,R*))- NH2-Phe-gly-his-sta-ala-phe-ome Phenylalanyl-glycyl-histidyl-statyl-alanyl-phenylalanine methyl ester

pdb file: 772252.pdb
sdf file: 772252.sdf
directory: 772252

112317-46-1 Hexapeptide 5 L-Phenylalanine, N-(N-(3-hydroxy-6-methyl-1-oxo-4-((N-(N-L-phenylalanylglycyl)-L-valyl)amino)heptyl)-L-alanyl)-, methyl ester, (S-(R*,R*))- NH2-Phe-gly-val-sta-ala-phe-ome Phenylalanyl-glycyl-valyl-statyl-alanyl-phenylalanine methyl ester

pdb file: 772253.pdb
sdf file: 772253.sdf
directory: 772253

113823-66-8 Benzyloxycarbonylphenylalanylarginyldiazomethane Carbamic acid, (2-((4-((aminoiminomethyl)amino)-1-(diazoacetyl)butyl)amino)-2-oxo-1-(phenylmethyl)ethyl)-, phenylmethyl ester, (S-(R*,R*))- Carbobenzoxyphenylalanylarginyldiazomethane Cbz-phe-arg-chn2

pdb file: 772326.pdb
sdf file: 772326.sdf
directory: 772326

113846-97-2 2-Gly-des-gly-2-phe-8-orn-vasopressin 2-Glycyl-9-desglycyl-2-phenylalanyl-8-ornithine vasopressin 2G-DS-P-Ovp Vasopressin, 2-gly-9-des-gly-2-phe-8-orn- Vasopressin, 2-glycyl-9-desglycyl-2-phenylalanyl-8-ornithine-

pdb file: 772329.pdb
sdf file: 772329.sdf
directory: 772329

114376-16-8 L-Tyrosinamide, N-(2-((N-(N-(1-(N-acetyl-1-formyl-L-tryptophyl)-L-prolyl)-L-phenylalanyl)-L-histidyl)amino)-3-phenylpropyl)-L-phenylalanyl-L-valyl-, (S)- U 70714E U-70714E

pdb file: 772363.pdb
sdf file: 772363.sdf
directory: 772363

114892-66-9 Fprf amide Fprf-amide Phe-pro-arg-phe-NH2 Phe-pro-arg-phe-amide Phenylalanyl-prolyl-arginyl-phenylalaninamide

pdb file: 772406.pdb
sdf file: 772406.sdf
directory: 772406

115464-33-0 LAPPL N-(N-(Lysergyl)-ala-)-phe-pro-lactam N-(N-(Lysergyl)-alanyl)-phenylalanyl-proline lactam

pdb file: 772429.pdb
sdf file: 772429.sdf
directory: 772429

115664-72-7 Ant-ala-ala-phe-4NA N-Anthraniloyl-alanyl-alanyl-phenylalanyl-4-nitroanilide

pdb file: 772437.pdb
sdf file: 772437.sdf
directory: 772437

(4-Morpholinylcarbonyl)-L-phenylalanyl-N-(1-(cyclohexylmethyl)-2-hydroxy-2-(1H-imidazol-2-yl)ethyl)-L-histidinamide 115766-42-2 L-Histidinamide, N-(4-morpholinylcarbonyl)-L-phenylalanyl-N-(1-(cyclohexylmethyl)-2-hydroxy-2-(1H-imidazol-2-yl)ethyl)-, (R-(R*,S*))- SQ 31844 SQ-31844

pdb file: 772443.pdb
sdf file: 772443.sdf
directory: 772443

115834-39-4 Tavtgagas Tyr-ala-val-thr-gly-arg-gly-asp-ser Tyrosyl-alanyl-valyl-threonyl-glycyl-arginyl-glycyl-aspartyl-serine

pdb file: 772445.pdb
sdf file: 772445.sdf
directory: 772445

117345-97-8 Boc-ala-psi(CH2S)-phe-OH Boc-ala-thiomethylene-phe-OH tert-Butoxycarbonylalanyl-psi-thiomethylene-phenylalanine

pdb file: 772485.pdb
sdf file: 772485.sdf
directory: 772485

117722-95-9 Boc-ala-ala-pro-glu-pna tert-Butoxycarbonyl-alanyl-alanyl-prolyl-glutamyl-4-nitroanilide

pdb file: 772505.pdb
sdf file: 772505.sdf
directory: 772505

117783-82-1 2-Ala-4-cyclopropyl-phe-leu-enkephalin methyl ester 2-Alanyl-4-cyclopropylphenylalanyl-leucine-enkephalin methyl ester CP-Ome-enkephalin Enkephalin-leu methyl ester, ala(2)-cyclopropyl-phe(4)- Leu-enkephalin methyl ester, ala(2)-cyclopropyl-phe(4)- Leucine-enkephalin methyl ester, alanyl(2)-cyclopropylphenylalanyl(4)-

pdb file: 772511.pdb
sdf file: 772511.sdf
directory: 772511

117823-37-7 N-Succinyl-alanyl-methionyl-S-benzylcysteine-4-nitroanilide SAMBN

pdb file: 772512.pdb
sdf file: 772512.sdf
directory: 772512

118292-30-1 Cbz-phe-gly-NH-O-CO-(2,4,6-Me3)Ph Cpg hydroxamate tmp O-Mesitoyl N-benzyloxycarbonylphenylalanyl-glycine hydroxamate

pdb file: 772526.pdb
sdf file: 772526.sdf
directory: 772526

118593-84-3 Lys-phe-phe-phe-ile-ile-trp-och3 Lysyl-phenylalanyl-phenylalanyl-phenylalanyl-isoleucyl-isoleucyl-tryptophyl methyl ester

pdb file: 772540.pdb
sdf file: 772540.sdf
directory: 772540

118643-58-6 Cck-itgnno2P Cholecystokinin (26-33), I-tyr-gly-(nle(28,31),4-No2-phe(33)) Cholecystokinin (26-33), iodotyrosyl-glycyl-(norleucyl(28,31))-para-No2-phenylalanyl(33) I-Tyr-gly-(28,31-nle-33-p-No2-phe)-cholecystokinin (26-33)

pdb file: 772542.pdb
sdf file: 772542.sdf
directory: 772542

119625-53-5 CP 85339 CP-85,339 Isopropyl-4-cyclohexyl-2-hydroxy-3-((propyl-L-phenylalanyl-5-methyl-L-cysteinyl)amino)butanoate hydrochloride L-Cysteinamide, L-prolyl-L-phenylalanyl-N-(1-(cyclohexylmethyl)-2-hydroxy-3-(1-methylethoxy)-3-oxopropyl)-S-methyl-, monohydrochloride, (R-(R*,S*))-

pdb file: 772586.pdb
sdf file: 772586.sdf
directory: 772586

119720-81-9 DFKi L 708286 L-708286 L-Prolinamide, N-acetyl-L-alanyl-N-(3,3-difluoro-1-(1-methylethyl)-2,4-dioxo-4-((2-phenylethyl)amino)butyl)-, (S)- L708286

pdb file: 772592.pdb
sdf file: 772592.sdf
directory: 772592

120218-55-5 Ala-arg-arg-CH2-S+(CH3)2 Alanyl-arginyl-arginylmethyldimethylsulfonium

pdb file: 772598.pdb
sdf file: 772598.sdf
directory: 772598

121584-61-0 CP 81282 CP-81,282 L-Norleucinamide, N-(4-morpholinylcarbonyl)-L-phenylalanyl-N-(1-(cyclohexylmethyl)-3,3-difluoro-4-(methylamino)-2,4-dioxobutyl)-, (S)-

pdb file: 772609.pdb
sdf file: 772609.sdf
directory: 772609

122211-31-8 Cyclo(L-isoleucyl-D-hexahydro-3-pyridazinecarbonyl-L-hexahydro-3-pyridazinecarbonyl-N-methyl-D-phenylalanyl-L-prolyl-D-phenylalanyl) Cyclo(ile-hexahydro-3-pyridazinecarbonyl-hexahydro-3-pyridazinecarbonyl-N-Me-phe-pro-phe) L 364,918 L 364918 L-364918

pdb file: 772628.pdb
sdf file: 772628.sdf
directory: 772628

123218-79-1 BCPLT Cyclo(glu-leu-pro-gly-ser-ile-pro-ala)cyclo((1-5)phe-gly) Cyclo(glutamyl-leucyl-prolyl-glycyl-seryl-isoleucyl-prolyl-alanyl)cyclo((1-5)phenylalanyl-glycine)

pdb file: 772653.pdb
sdf file: 772653.sdf
directory: 772653

124646-43-1 GR 70982 GR-70982 N-(5-((4-Aminobutyl)amino)-2-hydroxy-5-oxo-1-(cyclohexylmethyl)-4-(4-pyridinylmethyl)-1-pentyl)-N-((1,1-dimethylethoxy)carbonyl)phenylalanyl-L-histidinamide

pdb file: 772675.pdb
sdf file: 772675.sdf
directory: 772675

124883-38-1 Hypeptin L-Isoleucine, N-(N-(N-(N2-(N2-(N2-(N-L-alanyl-D-leucyl)-D-arginyl)-erythro-3-hydroxy-L-asparaginyl)-erythro-3-hydroxy-D-asparaginyl)-erythro-beta-hydroxy-L-tyrosyl)-threo-3-hydroxy-L-leucyl)-, lambda-lactone

pdb file: 772684.pdb
sdf file: 772684.sdf
directory: 772684

125482-08-8 Boc-tggp-csnh-LB Boc-tyr-gly-gly-phe-psi(csnh)leu-O-bzl t-Butyloxycarbonyltyrosyl-glycyl-glycyl-phenylalanyl-psi(thioamide)leucyl benzyl ester

pdb file: 772704.pdb
sdf file: 772704.sdf
directory: 772704

125989-15-3 Glycinamide, N-acetyl-L-leucyl-L-methionyl-L-glutaminyl-L-tryptophyl-L-phenylalanyl- L 659874 L-659874

pdb file: 772719.pdb
sdf file: 772719.sdf
directory: 772719

127132-36-9 Boc-aaet Boc-ala-ala-O'-(2,3-epoxypropyl)-tyr-ethyl ester N-(tert-Butoxycarbonyl)alanyl-alanyl-O'-(2,3-epoxypropyl)tyrosine ethyl ester

pdb file: 772780.pdb
sdf file: 772780.sdf
directory: 772780

127305-92-4 O-((-((N-(Phenylmethoxycarbonyl)alanyl)amino)ethyl)hydroxyphosphinyl)-3-phenylacetate Zaa-P(O)F

pdb file: 772786.pdb
sdf file: 772786.sdf
directory: 772786

127896-98-4 2,2'-O-(2,2'-Diacetamido-2,3,2',3'-tetradeoxy-6,6'-di-O-(2-tetradecylhexadecanoyl)-alpha,alpha'-trehalose-3,3'-diyl)bis(N-lactoyl-alanyl-isoglutamine) D-alpha-Glutamine, N2-(N-(N-acetyl-1-O-(N2-acetyl-N8-(2-((1-(aminocarbonyl)-3-carboxypropyl)amino)-1-methyl-2-oxoethyl)-6-O-(1-oxo-2-tetradecylhexadecyl)-alpha-muramamidosyl)-6-O-(1-oxo-2-tetradecylhexadecyl)-alpha-muramoyl)-L-alanyl)- Dttdt-mdp

pdb file: 772814.pdb
sdf file: 772814.sdf
directory: 772814

128595-42-6 Ala-phosphate Alanine phosphate Alanylphosphate

pdb file: 772842.pdb
sdf file: 772842.sdf
directory: 772842

128802-73-3 Suc-ala-phe-pro-phe-pna Suc-apppa Succinimidyl-alanyl-phenylalanyl-prolyl-phenylalanine 4-nitroanilide

pdb file: 772851.pdb
sdf file: 772851.sdf
directory: 772851

129229-16-9 N-Boc-phe-dehydro-leu-val-och3 N-Butyloxycarbonyl-phenylalanyl-dehydroleucyl-valine methyl ester Nbdlv-och3

pdb file: 772872.pdb
sdf file: 772872.sdf
directory: 772872

129445-88-1 ES 8891 ES-8891 L-threo-Pentonamide, 5-cyclohexyl-2,4,5-trideoxy-N-hexyl-4-((N-(3-(1-naphthalenyl)-N-(4-morpholinylacetyl)-L-alanyl)-3-(4-thiazolyl)-L-alanyl)amino)- N-Morpholinoacetyl-(1-naphthyl)-L-alanyl-(4-thiazolyl)-L-alanyl-4-amino-3-hydroxy-5-cyclohexylpentanoyl-n-hexylamide

pdb file: 772884.pdb
sdf file: 772884.sdf
directory: 772884

130192-64-2 21-Glutamyl-22-phenylalanyl-grp (21-27) Gastrin releasing peptide (21-27), glu(21)-phe(22)- Glu(21)-phe(22)-gastrin releasing peptide (21-27) Glu(21)-phe(22)-grp(21-27)

pdb file: 772909.pdb
sdf file: 772909.sdf
directory: 772909

130640-26-5 Balalom Boc-aib-ala-leu-ala-leu-aib-leu-ala-leu-aib-ome Butyloxycarbonyl-aminoisobutyryl-alanyl-leucyl-alanyl-leucyl-aminoisobutyryl-leucyl-alanyl-leucyl-aminoisobutyryl methyl ester

pdb file: 772922.pdb
sdf file: 772922.sdf
directory: 772922

130926-95-3 H-Phe-pro-boroarg-OH Phenylalanyl-prolyl-boroarginine

pdb file: 772932.pdb
sdf file: 772932.sdf
directory: 772932

131086-54-9 Ile-cyclo(beta-HL-thr-ser-beta-HL-delta-abu-ser-dehydro-trp-orn-phe) Isoleucyl-cyclo(beta-hydroxyleucyl-threonyl-seryl-beta-hydroxyleucyl-2,3-dehydro-alpha-aminobutyric acid-seryl-dehydrotryptophyl-ornithyl-phenylalanyl) Janthinocin C

pdb file: 772934.pdb
sdf file: 772934.sdf
directory: 772934

131176-01-7 Cyclo(phenylalanyl-4-fluoro-prolyl) Cylco(phe-4-F-pro) c(Phe-fpro)

pdb file: 772936.pdb
sdf file: 772936.sdf
directory: 772936

132413-71-9 Boc-ala-dehydrophe-gly-dehydrophe-ala-ome Boc-ala-dphe-gly-dphe-ala-ome tert-Butyloxycarbonyl-alanyl-dehydrophenylalanyl-glycyl-dehydrophenylalanyl-alanyl-methoxy

pdb file: 772973.pdb
sdf file: 772973.sdf
directory: 772973

135154-02-8 L-Asparagine, L-methionyl-L-prolyl-L-lysyl-L-alpha-glutamyl-L-lysyl-L-valyl-L-phenylalanyl-L-leucyl-L-lysyl-L-isoleucyl-L-alpha-glutamyl-L-lysyl-L-methionylglycyl-L-arginyl-L-asparaginyl-L-isoleucyl-L-arginyl- Vishnu

pdb file: 773041.pdb
sdf file: 773041.sdf
directory: 773041

135307-06-1 Glycine, L-valyl-L-threonyl-L-leucyl-L-tyrosyl-L-glutaminyl-L-seryl-L-tryptophyl-L-arginyl-L-tyrosyl-L-seryl-L-glutaminyl-L-alanyl-L-alpha-aspartyl-L-asparaginyl- Tendamistat (12-26)

pdb file: 773048.pdb
sdf file: 773048.sdf
directory: 773048

135467-95-7 Phe-gly-leu-gln-leu-glu-leu-thr Phenylalanyl-glycyl-leucyl-glutaminyl-leucyl-glutamyl-leucyl-threonine Sop octapeptide

pdb file: 773054.pdb
sdf file: 773054.sdf
directory: 773054

135705-19-0 Ac-D-Arg(hyp(3)-D-phe(7)-leu(8))-bradykinin Ac-R4FL-Bradykinin Acetyl-arg-3-hyp-7-phe-8-leu-bradykinin Bradykinin, acetyl-arg-hyp(3)-phe(7)-leu(8)- Bradykinin, acetyl-arginyl-4-hydroxyprolyl(3)-phenylalanyl(7)-leucyl(8)-

pdb file: 773072.pdb
sdf file: 773072.sdf
directory: 773072

136767-21-0 Adpvvoch3 N-Ac-Dehydro-phe-val-val-och3 N-Acetyldehydrophenylalanyl-valyl-valine methyl ester

pdb file: 773090.pdb
sdf file: 773090.sdf
directory: 773090

137348-25-5 APAPM Ac (delta)Phe-ala-(delta)-phe-NH-Me Acetyl dehydrophenylalanyl-alanyl-N-methyldehydrophenylalaninamide

pdb file: 773098.pdb
sdf file: 773098.sdf
directory: 773098

137476-73-4 Cyclo(tyr-gly-gly-ala-ala-val) Cyclo(tyrosyl-glycyl-glycyl-alanyl-alanyl-valyl) Stellaria cyclopeptide

pdb file: 773101.pdb
sdf file: 773101.sdf
directory: 773101

75795-03-8 Acetyl-ala-ala-tyr Acetyl-alanyl-alanyl-tyrosine CH3CO-Ala-ala-tyr L-Tyrosine, N-(N-(N-acetyl-L-alanyl)-L-alanyl)-

pdb file: 773119.pdb
sdf file: 773119.sdf
directory: 773119

76079-06-6 FA-Ala-arg Furylacryloyl-ala-arg Furylacryloyl-alanyl-arginine Furylacryloylalanylarginine L-Arginine, N(2)-(N-(3-(2-furanyl)-1-oxo-2-propenyl)-L-alanyl)-

pdb file: 773148.pdb
sdf file: 773148.sdf
directory: 773148

4-Hydroxyphenyl-Me-2-Me-5-oxo-1-imidazolid-Ac-gly-phe-leu 76157-62-5 Enkephalin-leu, acetaldehyde- L-Leucine, N-(N-(N-((4-((4-hydroxyphenyl)methyl)-2-methyl-5-oxo-1-imidazolidinyl)acetyl)glycyl)-L-phenylalanyl)- Leu-enkephalin, acetaldehyde- Leucine enkephalin, acetaldehyde- N-(N-(N-((4-((4-Hydroxyphenyl)methyl)-2-methyl-5-oxo-1-imidazolid-inyl)acetyl)glycyl)-phenylalanyl)-leucine

pdb file: 773160.pdb
sdf file: 773160.sdf
directory: 773160

76995-89-6 Azo-enkephalin Azoenkephalin Enkephalin-leu, 4-(5-(2-amino-2-carboxyethyl)-2-hydroxyphenyl)azo- L-Leucine, glycylglycyl-4-((5-(2-amino-2-carboxyethyl)-2-hydroxyphenyl)azo)-L-phenylalanyl-, cyclic (3-1)-peptide

pdb file: 773229.pdb
sdf file: 773229.sdf
directory: 773229

4-(Hydroxyphenyl)azo-leucine enkephalin 76995-91-0 Enkephalin-leu, 4-(hydroxyphenyl)azo- L-Leucine, N-(4-((hydroxyphenyl)azo)-N-(N-(N-L-tyrosylglycyl)glycyl)-L-phenylalanyl)- Leu-enkephalin-4-(hydroxyphenyl)azo TGGAP

pdb file: 773230.pdb
sdf file: 773230.sdf
directory: 773230

1,4,7-Triazacyclotridecane-3,6,13-trione, 5-(2-(methylthio)ethyl)-2-(phenylmethyl)-, (2S-(2R*,5R*))- 77052-97-2 Cpmeahxa Cyclo(phe-met-epsilon-aminohexanoic acid) Cyclo(phenylalanylmethionine-epsilon-aminohexanoic acid)

pdb file: 773236.pdb
sdf file: 773236.sdf
directory: 773236

6-Pglu-7-N-mephe-substance P (6-11) 77160-85-1 GMPSP L-Methioninamide, 5-oxo-L-prolyl-N-methyl-L-phenylalanyl-L-phenylalanylglycyl-L-leucyl- Substance P (6-11), pglu(6)-N-mephe(7)- Substance P (6-11), pyroglutamyl(6)-N-methylphenylalanine(7)-

pdb file: 773247.pdb
sdf file: 773247.sdf
directory: 773247

6-Pglu-10-N-meleu-substance P (6-11) 77160-86-2 GMLSP L-Methioninamide, 5-oxo-L-prolyl-L-phenylalanyl-L-phenylalanylglycyl-N-methyl-L-leucyl- Substance P (6-11), pglu(6)-N-meleu(10)- Substance P (6-11), pyroglutamyl(6)-N-methylleucine(10)-

pdb file: 773248.pdb
sdf file: 773248.sdf
directory: 773248

77171-72-3 Cyclo-N(gamma)-dinh-butyryl-leu-enkephalin Enkephalin-leu, cyclo-N(gamma)-diaminobutyryl- Enkephalin-leu, cyclo-N(gamma)-dinh-butyryl- L-Leucine, L-tyrosyl-D-alpha,gamma-diaminobutyrylglycyl-L-phenylalanyl-, cyclic (5-2)-peptide Leu-enkephalin, cyclo-N(gamma)-dinh-butyryl- Leucine-enkephalin, cyclo-N(gamma)-dinh-butyryl- TABGP Tyr-cyclo(-N(gamma)-D-A2-bu-gly-phe-leu-)

pdb file: 773252.pdb
sdf file: 773252.sdf
directory: 773252

77180-12-2 Benzyloxycarbonylalanyl-alanyl-proline diazomethyl ketone Carbamic acid, (2-((2-(2-(diazoacetyl)-1-pyrrolidinyl)-1-methyl-2-oxoethyl)amino)-1-methyl-2-oxoethyl)-, phenylmethyl ester, (2S-(1(R*(R*)),2R*))- Z-Ala-ala-prochn2

pdb file: 773256.pdb
sdf file: 773256.sdf
directory: 773256

77303-12-9 Boc-aapil Boc-alanyl-alanyl-phenylalanine-isoluminolamide Butyloxycarbonyl-alanyl-alanyl-phenylalanine-isoluminolamide L-Phenylalaninamide, N-((1,1-dimethylethoxy)carbonyl)-L-alanyl-L-alanyl-N-(1,2,3,4-tetrahydro-1,4-dioxo-6-phthalazinyl)- tert-Butyloxycarbonyl-ala-ala-phe-isoluminolamide

pdb file: 773265.pdb
sdf file: 773265.sdf
directory: 773265

1-Pyroglutamyl-2-phenylalanyl-3,6-(3-(1-naphthyl)alanine)-LHRH 78255-70-6 GNRH, pglu(1)-phe(2)-3-(1-naphthyl)ala(3,6)- LHRH, Pyroglutamyl(1)-phenylalanyl(2)-3-(1-naphthyl)alanine(3,6)- LHRH, pglu(1)-phe(2)-3-(1-naphthyl)ala(3,6)- Luteinizing hormone-releasing factor, 1-(5-oxo-D-proline)-2-D-phenylalanine-3-(3-(1-naphthalenyl)-D-alanine)-6-(3-(1-naphthalenyl)-D-alanine)- Wy 43657 Wy-43,657

pdb file: 773318.pdb
sdf file: 773318.sdf
directory: 773318

1-Penicillamyl-2-phe-4-thr-oxytocin 1-Ppt-oxytocin 78578-27-5 Oxytocin, 1-(3-mercapto-D-valine)-2-L-phenylalanine-4-L-threonine- Oxytocin, 1-penicillamyl-phe(2)-thr(4)- Oxytocin, 1-penicillamyl-phenylalanyl(2)-threonine(4)-

pdb file: 773341.pdb
sdf file: 773341.sdf
directory: 773341

6-Arg-7-phenh2-met-enkephalin 78761-61-2 Enkephalin-met, arg(6)-phenh2(7)- Enkephalin-met, arginyl(6)phenylalaninamide(7)- L-Phenylalaninamide, L-tyrosylglycylglycyl-L-phenylalanyl-L-methionyl-L-arginyl- Meapaa Met-enkephalin, arg(6)-phenh2(7)- Methionine-enkephalin, arg(6)-phenh2(7)- Yggfmrf amide

pdb file: 773350.pdb
sdf file: 773350.sdf
directory: 773350

79438-64-5 L-Alaninamide, N6-((5-((4-amino-1,4-dioxobutyl)amino)-2,3,5,6-tetrahydro-8,9-dihydroxy-1H-pyrimido(1,2-a)quinolin-1-yl)carbonyl)-L-lysyl-threo-3-hydroxy-D-alpha-aspartyl-L-alanyl-D-allothreonyl-N-(1-hydroxy-2-oxo-3-piperidinyl)- Pseudobactin A

pdb file: 773366.pdb
sdf file: 773366.sdf
directory: 773366

80318-70-3 Asp-arg-pepstatyl Isovaleryl-valyl-valyl-statyl-alanylstatyl-aspartic acid-arginine Isovaleryl-valyl-valylstatyl-ala-statyl-asp-arg Pepstatin A, 5a-L-aspartic acid-5b-(N5-(imino(nitroamino)methyl)-L-ornithine)-, bis(phenylmethyl) ester Pepstatyl, asp-arg- Pepstatyl, aspartyl-arginine-

pdb file: 773396.pdb
sdf file: 773396.sdf
directory: 773396

3-Dehydro-ala-enkephalin 81851-82-3 Enkephalin, dehydro-ala(3)- Enkephalin, dehydroalalnine(3)- L-Leucine, N-(N-(2,3-didehydro-N-(N-L-tyrosylglycyl)alanyl)-L-phenylalanyl)-

pdb file: 773436.pdb
sdf file: 773436.sdf
directory: 773436

82080-04-4 Copoly(L-alanine, L-methionine) Copoly(alanine, methionine) L-Methionine, N-L-alanyl-, homopolymer Poly(ala, met)

pdb file: 773440.pdb
sdf file: 773440.sdf
directory: 773440

5(S)-Hydroxy-6(R)-glutathionyl-7-9-trans-11,14-cis-eicosatetraenoic acid-S,S-dioxide 82890-06-0 Glycine, N-(3-((1-(4-carboxy-1-hydroxybutyl)-2,4,6,9-pentadecatetraenyl)sulfonyl)-N-L-gamma-glutamyl-L-alanyl)-, (R-(R*,S*-(E,E,Z,Z)))- Leukotriene C-4 sulfone

pdb file: 773458.pdb
sdf file: 773458.sdf
directory: 773458

83487-84-7 Gly-lys-lys-pepstatyl Isovaleryl-valyl-valyl-statyl-ala-statyl-gly-lys-lys Isovaleryl-valyl-valylstatyl-alanylstatyl-glycyl-lysyl-lysine L-Lysine, N2-(N2-(N-(3-hydroxy-4-((2-((3-hydroxy-6-methyl-4-((N-(N-(3-methyl-1-oxobutyl)-L-valyl)-L-valyl)amino)-1-oxoheptyl)amino)-1-oxopropyl)amino)-6-methyl-1-oxoheptyl)glycyl)-L-lysyl)-, stereoisomer Pepstatyl, gly-lys-lys- Pepstatyl, glycyl-lysyl-lysine-

pdb file: 773474.pdb
sdf file: 773474.sdf
directory: 773474

83487-85-8 Acetylmuramyl-L-alanyl-isoglutaminyl-meso-2,2'-diaminopimelic acid-alanylalanine Acmu-L-ala-gamma-D-gln-meso-A2pm-ala-ala Acmu-ala-iso-gln-meso-2,2'-diaminopimelic acid-ala-ala D-Alanine, N-(N-acetylmuramoyl)-L-alanyl-D-alpha-glutaminyl-meso-alpha,epsilon-diaminopimelyl-D-alanyl- Muramyl pentapeptide

pdb file: 773475.pdb
sdf file: 773475.sdf
directory: 773475

84107-30-2 Cyclic(L-alanyl-L-prolyl-D-phenylalanyl-L-prolyl), compd. with cyclic(L-alanyl-L-prolyl-L-phenylalanyl-L-prolyl) (1:1) Cyclo(L-ala-L-pro-D-phe-L-pro) Cyclo(L-ala-L-pro-L-phe-L-pro) Cyclo(ala-pro-phe-pro) Cyclo(alanyl-prolyl-phenylalanyl-proline)

pdb file: 773489.pdb
sdf file: 773489.sdf
directory: 773489

84692-81-9 Poly(ala-glu-tyr-gly) Poly(alanyl-glutamyl-tyrosyl-glycine)

pdb file: 773504.pdb
sdf file: 773504.sdf
directory: 773504

91921-56-1 Insulin (B20-B30) Insulin B (20-30) L-Alanine, N-(N2-(1-(N-(N-(N-(N-(N-(N2-(N-glycyl-L-alpha-glutamyl)-L-arginyl)glycyl)-L-phenylalanyl)-L-phenylalanyl)-L-tyrosyl)-L-threonyl)-L-prolyl)-L-lysyl)-, (3aS-(3aalpha,4beta,6aalpha))-

pdb file: 773514.pdb
sdf file: 773514.sdf
directory: 773514

27-N-5-CH 27-Nor-5beta-cholestane-3alpha,7alpha,12alpha,24alpha,24xi,25xi,26-hexol 27-Norcholestane-3,7,12,24,25,26-hexol 27-Norcholestane-3,7,12,24,25,26-hexol, N-(N2-(1-(N-(N-(N-(N-(N-(N2-(N-glycyl-L-alpha-glutamyl)-L-arginyl)glycyl)-L-phenylalanyl)-L-phenylalanyl)-L-tyrosyl)-L-threonyl)-L-prolyl)-L-lysyl)-, (3alpha,5beta,7alpha,12alpha)- 91999-66-5

pdb file: 773516.pdb
sdf file: 773516.sdf
directory: 773516

92131-67-4 L-Alaninamide, N-acetyl-L-alanyl-L-alanyl-N-(4-((7-((5-(acetylamino)-6-amino-1,6-dioxohexyl)amino)-2-carboxy-7-(formylamino)-8-oxo-5-thia-1-azabicyclo(4.2.0)oct-2-en-3-yl)methoxy)-1-(3-((aminoiminomethyl)amino)propyl)-2-hydroxy-4-oxobutyl)- SQ 28517 SQ-28517

pdb file: 773518.pdb
sdf file: 773518.sdf
directory: 773518

2-N,N-Diallyl-ala-bis(cystine)(6)-leu-enkephalin 93450-55-6 Bdaales Bis(N,N-diallyl-2-alanyl-5-leucine-enkephalyl)cystine Enkephalin-leu, N,N-diallyl-ala(2)-bis(cystine)(6)- Enkephalin-leu, N,N-diallylalanine(2)-bis(cystine)(6)- Leu-enkephalin, N,N-diallyl-ala(2)-bis(cystine)(6)- Leucine-enkephalin,-N,N-diallyl-ala(2)-bis(cystine)(6)-

pdb file: 773526.pdb
sdf file: 773526.sdf
directory: 773526

4-Pro-7,9-npa-11-phe-substance P (4-11) 4-Prolyl-7,9-naphthylalanyl-11-phenylalanine-substance P (4-11) 93490-35-8 L-Phenylalaninamide, D-prolyl-L-glutaminyl-L-glutaminyl-3-(1-naphthalenyl)-D-alanyl-L-phenylalanyl-3-(1-naphthalenyl)-D-alanyl-L-leucyl-, (3beta)- PNPSP Substance P (4-11), pro(4)-npa(7,9)-phe(11)- Substance P (4-11), prolyl(4)-naphthylalanyl(7,9)-phenylalanine(11)-

pdb file: 773527.pdb
sdf file: 773527.sdf
directory: 773527

(Boc-cys-ala-cys-nhch3)2 (N-tert-Butyloxycarbonyl-cysteinyl-alanyl-cysteinyl-methylamide)2 93629-01-7 BCACN

pdb file: 773533.pdb
sdf file: 773533.sdf
directory: 773533

98612-56-7 Ethanesulfonamide, N-(1,3,4,6,7,12b-hexahydro-2H-benzo(b)furo(2,3-a)quinolizin-2-yl)-N-methyl-2-hydroxy- Hbfqmh L 654284 L-654,284 L-Lysinamide, O-ethyl-N-((1-mercaptocyclohexyl)acetyl)-D-tyrosyl-L-phenylalanyl-L-valyl-L-asparaginyl-L-cysteinyl-, cyclic (1-5)-disulfide N-(1,3,4,6,7,12b-Hexahydro-2H-benzo(b)furo(2,3-a)quinolizin-2-yl)-N-methyl-2-hydroxyethanesulfonamide

pdb file: 773561.pdb
sdf file: 773561.sdf
directory: 773561

1-Sar-4-phe-8-ile-angiotensin II 1-Sarcosyl-4-phenylalanyl-8-isoleucine-angiotensin II 98641-01-1 Angiotensin II, sar(1)-phe(4)-ile(8)- Angiotensin II, sarcosyl(1)-phenylalanyl(4)-isoleucine(8)-

pdb file: 773562.pdb
sdf file: 773562.sdf
directory: 773562

98751-93-0 Lpigppal Lys-pro-ile-glu-phe-phe(4-No2)-arg-leu Lysyl-prolyl-isoleucyl-glutamyl-phenylalanyl-4-nitrophenylalanyl-arginyl-leucine

pdb file: 773564.pdb
sdf file: 773564.sdf
directory: 773564

2-Ala-4-Me-phe-leu-enkephalin 64963-13-9 DAMLE Enkephalin-leu, ala(2)-Me-phe(4)- Enkephalin-leu, alanine(2)-Me-phe(4)- L-Leucine, N-(N-(N-methyl-N-(N-L-tyrosyl-D-alanyl)glycyl)-L-phenylalanyl)-, (3S-(3alpha,4abeta,5beta,6beta,6aalpha,10alpha,10abeta,10balpha))- Leu-enkephalin, ala(2)-Me-phe(4)- Leucine-enkephalin, ala(2)-Me-phe(4)-

pdb file: 773643.pdb
sdf file: 773643.sdf
directory: 773643

65319-55-3 L-Alaninamide, L-phenylalanyl-N-(4-((aminoiminomethyl)amino)-1-(chloroacetyl)butyl)-, (S)- Phe-ala-arg-CK Phe-ala-arg-chloromethyl ketone Phenylalanyl-alanyl-arginine chloromethyl ketone

pdb file: 773650.pdb
sdf file: 773650.sdf
directory: 773650

65717-73-9 D-Alanine, N-(N-(N2-(N-(N-(N-acetyl-1-O-(hydroxy((hydroxy((3,7,11,15,19,23,27,31,35,39,43-undecamethyl-2,6,10,14,18,22,26,30,34,38,42-tetratetracontaundecaenyl)oxy)phosphinyl)oxy)phosphinyl)-alpha-muramoyl)-L-alanyl)-D-gamma-glutamyl)-N6-((5-(dimethylamino)-1-naphthalenyl)sulfonyl)-L-lysyl)-D-alanyl)- Udmnad pentapeptide Undecaprenyl diphosphate-N-acetylmuramoyl-(5-dimethylaminonaphthalene-1-sulfonyl)pentapeptide Undecaprenyl diphosphate-N-acetylmuramyl-(N(epsilon)-dansyl)pentapeptide Undecaprenyl diphosphate-murnac-(N(epsilon)-dansyl)pentapeptide

pdb file: 773656.pdb
sdf file: 773656.sdf
directory: 773656

68374-47-0 8-Octapeptide-trp-somatostatin 8-Octapeptide-trp-srih 8-Octapeptidetryptophan-somatostatin Cys-phe-phe-D-trp-lys-thr-phe-D-cys Cys-phe-phe-D-trp-lys-thr-phe-cys Des-AA(1,2,4,5,12,13)-8-trp-14-cys-SS Des-AA(1,2,4,5,12,13)-8-trp-somatostatin L-Cysteine, N-(N-(N-(N2-(N-(N-(N-L-cysteinyl-L-phenylalanyl)-L-phenylalanyl)-D-tryptophyl)-L-lysyl)-L-threonyl)-L-phenylalanyl)- Odt8-SS Somatostatin, octapeptide-trp(8)- Somatostatin, octapeptidetryptophan(8)-

pdb file: 773673.pdb
sdf file: 773673.sdf
directory: 773673

68739-16-2 L-Alaninamide, N-(trifluoroacetyl)-L-alanyl-N-(4-nitrophenyl)- Tfadana Trifluoroacetyl-dialanine-4-nitroanilide Trifluoroacetyl-dialanine-p-nitroanilide

pdb file: 773677.pdb
sdf file: 773677.sdf
directory: 773677

6,7-Arg-met-enkephalin 76496-10-1 Enkephalin-met, arg(6,7)- Enkephalin-met, arginine(6,7)- L-Arginine, N2-(N2-(N-(N-(N-(N-L-tyrosylglycyl)glycyl)-L-phenylalanyl)-L-methionyl)-L-arginyl)- Met-enk-AA Met-enkephalin, arg(6,7)- Methionine-enkephalin, arg(6,7)-

pdb file: 773688.pdb
sdf file: 773688.sdf
directory: 773688

76960-26-4 Ala(2)-leu(5)-enkephalin chloromethyl ketone Alanine(2)-leucine(5) enkephalin chloromethyl ketone Alanine(2)-leucine(5)-enkephalin chloromethyl ketone Daleck L-Phenylalaninamide, L-tyrosyl-D-alanylglycyl-N-(1-(chloroacetyl)-3-methylbutyl)-, (S)- Tagplcmk Tyr-D-ala-gly-phe-leu-chloromethyl ketone Tyrosyl-alanyl-glycyl-phenylalanyl-leucine chloromethyl ketone

pdb file: 773701.pdb
sdf file: 773701.sdf
directory: 773701

77087-68-4 Cgppmg-dap Cyclic(3-(((2,5-dihydro-2,5-dioxo-1H-pyrrol-1-yl)acetyl)amino)-L-alanylglycyl-L-phenylalanyl-D-prolyl) Cyclo(gly-L-phe-D-pro-N(beta)-(N-mal-gly)-L-dap) Cyclo(gly-phe-pro-N(beta)-(N-mal-gly)-dap) Cyclo(glycyl-L-phenylalanyl-D-prolyl-N(beta)-(N-maleoylglycyl)-L-alpha,beta-diaminopropanoyl) Cyclo(glycyl-phenylalanyl-prolyl-N(beta)-(N-maleoylglycyl)-alpha,beta-diaminopropanoyl)

pdb file: 773704.pdb
sdf file: 773704.sdf
directory: 773704

77100-18-6 Cgppb-dap Cyclic(3-(((1,1-dimethylethoxy)carbonyl)amino)-L-alanylglycyl-L-phenylalanyl-D-prolyl) Cyclo(gly-L-phe-D-pro-N(beta)-boc-L-dap) Cyclo(gly-phe-pro-N(beta)-(tert-butyloxycarbonyl)-dap) Cyclo(glycyl-phenylalanyl-D-prolyl-N(beta)-(tert-butoxycarbonyl)-L-alpha,beta-diaminopropanoyl) Cyclo(glycyl-phenylalanyl-prolyl-N-(beta)-(tert-butoxycarbonyl)-alpha,beta-diaminopropanyoly)

pdb file: 773705.pdb
sdf file: 773705.sdf
directory: 773705

77236-35-2 Cyclo(L-lysyl-L-threonyl-L-phenylalanyl-L-prolyl-L-phenylalanyl-D-tryptophyl) Cyclo(trp-lys-thr-phe-pro-phe)acetate L 363568 L-363,568

pdb file: 773720.pdb
sdf file: 773720.sdf
directory: 773720

3-Trifluoromethylbenzoyl-dialanine-4-nitroanilide 78044-16-3 L-Alaninamide, N-(3-(trifluoromethyl)benzoyl)-L-alanyl-N-(4-nitrophenyl)- Tfmbdana m-Trifluoromethylbenzoyl-dialanine-p-nitroanilide

pdb file: 773737.pdb
sdf file: 773737.sdf
directory: 773737

1-N-Ac-Trp-2-(4-Cl-phe)-3-trp-6-phe-10-alanh2-LHRH 78493-59-1 Atcppa-LHRH D-Alaninamide, N-acetyl-D-tryptophyl-4-chloro-D-phenylalanyl-D-tryptophyl-L-seryl-L-tyrosyl-D-phenylalanyl-L-leucyl-L-arginyl-L-prolyl- GNRH, (N)-Ac-trp(1)-(4-Cl-phe)(2)-trp(3)-phe(6)-alanh2(10)- LHRH, (N)-Acetyltryptophyl(1)-4-chlorophenylalanyl(2)-tryptophyl(3)-phenylalanyl(6)-alaninamide LHRH, (N)-ac-Trp(1)-(4-Cl-phe)(2)-trp(3)-phe(6)-alanh2(10)-

pdb file: 773751.pdb
sdf file: 773751.sdf
directory: 773751

110786-00-0 Carbobenzoxy-phe(p)-leu-ala Carbobenzoxy-phenylalanyl(p)-leucyl-alanine ZF(p)LA

pdb file: 773850.pdb
sdf file: 773850.sdf
directory: 773850

111857-95-5 Bim 23034 Bim-23034 D-Alaninamide, D-phenylalanyl-L-cysteinyl-L-tyrosyl-D-tryptophyl-L-lysyl-L-valyl-L-cysteinyl-3-(2-naphthalenyl)-, cyclic (2-7)-disulfide Phe-cys-tyr-trp-lys-val-cys-3-(2-naphthyl)-ala-NH2

pdb file: 773874.pdb
sdf file: 773874.sdf
directory: 773874

112921-04-7 5'-O-(N-(Alanyl)sulfamoyl)adenosine Ala-SA

pdb file: 773885.pdb
sdf file: 773885.sdf
directory: 773885

122211-30-7 Cyclo(L-isoleucyl-D-2,3,4,5-tetrahydro-3-pyridazinecarbonyl-L-2,3,4,5-tetrahydro-3-pyridazinecarbonyl-N-methyl-D-phenylalanyl-L-prolyl-D-phenylalanyl) Cyclo(ile-2,3,4,5-tetrahydro-3-pyridazincecarbonyl-2,3,4,5-tetrahydro-3-pyridazinecarbonyl-N-Me-phe-pro-phe) L 365,209 L 365209 L-365209

pdb file: 773981.pdb
sdf file: 773981.sdf
directory: 773981

122548-04-3 Halocyamine B L-Histidinamide, L-threonyl-3-hydroxy-L-tyrosyl-N-((1Z)-2-(6-bromo-1H-indol-3-yl)ethenyl)- L-Histidinamide, L-threonyl-3-hydroxy-L-tyrosyl-N-(2-(6-bromo-1H-indol-3-yl)ethenyl)-, (Z)- Threonyl-6,7-dihydroxyphenylalanyl-histidyl-6-bromo-8,9-didehydrotryptamine

pdb file: 773984.pdb
sdf file: 773984.sdf
directory: 773984

123219-97-6 D-Alaninamide, N-acetyl-3-(1-naphthalenyl)-D-alanyl-4-chloro-D-phenylalanyl-3-(3-pyridinyl)-D-alanyl-L-seryl-L-tyrosyl-3-(3-pyridinyl)-D-alanyl-L-leucyl-N6-(bis(ethylamino)methylene)-L-lysyl-L-prolyl- GNRH, N-Ac-2-nal(1)-(4-Cl-phe)(2)-(3-pal)(3,6)-Et2-harg(8)-alanh2(10)- LHRH, N-Ac-2-Nal(1)-(4-Cl-phe)(2)-(3-pal)(3,6)-Et2-harg(8)-alanh2(10)- LHRH, N-Acetyl-(2-naphthylalanyl)-(4-chlorophenylalanyl)(2)-(3-pyridinylalanyl)(3,6)-diethylhomoarginyl-alaninamide(10)- N-Ac-(2-Naphthyl)ala-2-(4-Cl-phe)-3,6-(3-pal)-8-Et-arg-10-alanh2-LHRH RS 15378 RS-15378

pdb file: 773985.pdb
sdf file: 773985.sdf
directory: 773985

126657-82-7 Emd 55450 Emd-55450 L-threo-Pentonamide, N-(1-((((3-amino-5,6-dimethylpyrazinyl)methyl)amino)carbonyl)-2-methylbutyl)-5-cyclohexyl-2,4,5-trideoxy-4-((N-(N-(1-oxo-6-(((phenylmethoxy)carbonyl)amino)hexyl)-L-phenylalanyl)glycyl)amino)-, (S-(R*,R*))-

pdb file: 774012.pdb
sdf file: 774012.sdf
directory: 774012

137666-07-0 2,6-Dimethyl-tyr(1)-pen(2,5)-enkephalin 2,6-Dpdpe D-Valine, 2,6-dimethyl-L-tyrosyl-3-mercapto-D-valylglycyl-L-phenylalanyl-3-mercapto-, cyclic (2-5)-disulfide Enkephalin, 2,6-dimethyl-tyr(1)-pen(2,5)- Enkephalin, 2,6-dimethyl-tyrosyl(1)-penicillaminyl(2,5)-

pdb file: 774092.pdb
sdf file: 774092.sdf
directory: 774092

139346-17-1 BQ 153 BQ-153 Cyclo(3-sulfo-D-alanyl-L-prolyl-D-valyl-L-leucyl-D-tryptophyl) Cyclo(D-sal-L-pro-D-val-L-leu-D-trp-) Cyclo(sal-pro-val-leu-trp-) Cyclo(sulfoalanyl-prolyl-valyl-leucyl-tryptophyl) c(D-Trp-D-cys(SO3-Na+)-pro-D-val-leu)

pdb f