
|
gel Molecules Structural Archive and Gallery

106928-36-3 C08981 Toxyl angelate
pdb file: 10474.pdb sdf file: 10474.sdf directory: 10474

523-50-2 Angelicin C09060 Isopsoralen
pdb file: 10553.pdb sdf file: 10553.sdf directory: 10553

2607-56-9 Archangelicin C09116
pdb file: 10609.pdb sdf file: 10609.sdf directory: 10609

482-25-7 Byakangelicin C09141
pdb file: 10634.pdb sdf file: 10634.sdf directory: 10634

6887-28-1 C09203 Gelsemicine
pdb file: 10695.pdb sdf file: 10695.sdf directory: 10695

509-15-9 C09207 Gelsemine
pdb file: 10699.pdb sdf file: 10699.sdf directory: 10699

(3'R,4'R)-3'-Epoxyangeloyloxy-4'-acetoxy-3',4'-dihydroseselin 11350-35-9 C09262
pdb file: 10754.pdb sdf file: 10754.sdf directory: 10754

41929-11-7 Archangelolide C09296
pdb file: 10788.pdb sdf file: 10788.sdf directory: 10788

61273-75-4 C09886 Magellanine
pdb file: 11373.pdb sdf file: 11373.sdf directory: 11373

723-78-4 C10278 O-7-Angelylheliotridine Rivularine
pdb file: 11764.pdb sdf file: 11764.sdf directory: 11764

520-68-3 7-Angelyl-9-echimidinylretronecine C10299 Echimidine
pdb file: 11785.pdb sdf file: 11785.sdf directory: 11785

32728-78-2 7-Angelyl-9-echimidinylheliotridine C10319 Heliosupine
pdb file: 11805.pdb sdf file: 11805.sdf directory: 11805

303-34-4 7-Angelyl-9-lasiocarpylheliotridine C10341 Lasiocarpine
pdb file: 11827.pdb sdf file: 11827.sdf directory: 11827

80931-34-6 C10362 Kigelinone
pdb file: 11848.pdb sdf file: 11848.sdf directory: 11848

2492-09-3 7-Angelyl-9-sarracinylplatynecine C10383 Sarracine
pdb file: 11869.pdb sdf file: 11869.sdf directory: 11869

7-Angelyl-9-(-)-viridiflorylretronecine 74410-74-5 C10408 Symlandine
pdb file: 11894.pdb sdf file: 11894.sdf directory: 11894

6-Angelyl-9-sarracinylretronecine 87340-27-0 C10410 Triangularine
pdb file: 11896.pdb sdf file: 11896.sdf directory: 11896

30562-34-6 C11222 Geldanamycin
pdb file: 12691.pdb sdf file: 12691.sdf directory: 12691

.DELTA.2-Angelica lactone .alpha.(.beta.,.gamma. or .DELTA.2)-Angelica lactone .alpha.-Angelica lactone .beta.,.gamma.-Angelica lactone .delta.(2)-Angelica lactone 2(3H)-Furanone, 5-methyl- 3-Pentenoic acid, 4-hydroxy-, .gamma.-lactone 4-Hydroxy-3-pentenoic acid .gamma.-lactone 4-Hydroxypent-3-enoic acid lactone 5-Methylfuran-2(3H)-one 591-12-8 NSC654 PENTEN-3-OIC ACID, 4-HYDROXY-, GAMMA-LACTONE WLN: T5OV CHJ E1
pdb file: 50595.pdb sdf file: 50595.sdf directory: 50595

.DELTA.1-Angelica lactone .alpha.,.beta.-Angelica lactone .beta.(.alpha.,.beta. or .delta.1)-Angelica lactone .beta.-Angelica lactone .delta.(sup1)-Angelica lactone .gamma.-Methyl-.DELTA..alpha.,.beta.-butenolide .gamma.-Methyl-.alpha.,.beta.-crotonolactone 2(5H)-Furanone, 5-methyl- 2-Penten-4-olide 2-Pentenoic acid, 4-hydroxy-, .gamma.-lactone 4-Hydroxy-2-pentenoic acid .gamma.-lactone 4-Hydroxypent-2-enoic acid lactone 5-Methyl-2(5H)-furanone 591-11-7 NSC655 WLN: T5OV EHJ E1
pdb file: 50596.pdb sdf file: 50596.sdf directory: 50596

94-36-0 Acetoxyl Akneroxid 5 Asidopan Benoxyl Benzac Benzoic acid, peroxide Benzol peroxide Benzoperoxide Benzoyl Peroxide Benzoyl superoxide Benzoylperoxid Benzoylperoxyde DIBENZOYL PEROXIDE Dibenzoylperoxid Dibenzoylperoxyde Diphenylglyoxal peroxide Dry and Clear Duresthin 5 Eloxyl Epi-Clear G20 Lucidol Lucidol B 50 Lucidol G 20 Luperco AST Mytolac NSC671 Nayper BO Oxy 5 Oxylite Panoxyl Perossido di benzoile Peroxide, dibenzoyl Peroxyde de benzoyle Persa-Gel Persadox Resdan Akne Theraderm WLN: RVOOVR component of Oxy-5 component of Vanoxide
pdb file: 50609.pdb sdf file: 50609.sdf directory: 50609

94-36-0 Acetoxyl Akneroxid 5 Asidopan Benoxyl Benzac Benzoic acid, peroxide Benzol peroxide Benzoperoxide Benzoyl Peroxide Benzoyl superoxide Benzoylperoxid Benzoylperoxyde DIBENZOYL PEROXIDE Dibenzoylperoxid Dibenzoylperoxyde Diphenylglyoxal peroxide Dry and Clear Duresthin 5 Eloxyl Epi-Clear G20 Lucidol Lucidol B 50 Lucidol G 20 Luperco AST Mytolac NSC675 Nayper BO Oxy 5 Oxylite Panoxyl Perossido di benzoile Peroxide, dibenzoyl Peroxyde de benzoyle Persa-Gel Persadox Resdan Akne Theraderm WLN: RVOOVR component of Oxy-5 component of Vanoxide
pdb file: 50613.pdb sdf file: 50613.sdf directory: 50613

103-90-2 4'-Hydroxyacetanilide 4-Acetamidophenol 4-Acetaminophenol 4-Hydroxyacetanilide APAP Abensanil Acamol Accu-Tap Acetagesic Acetalgin Acetamide, N-(4-hydroxyphenyl)- Acetamide, N-(p-hydroxyphenyl)- Acetaminofen Acetaminophen Acetanilide, 4'-hydroxy- Algotropyl Alpiny Alvedon Amadil Anaflon Anapap Anelix Anhiba Apadon Apamid Apamide Ben-u-ron Bickie-mol Calpol Cetadol Clixodyne Conacetol Datril Dial-A-Gesic Dimindol Dirox Dularin Dymadon Dypap Elixodyne Eneril Febridol Febrilix Febrinol Febro-Gesic Febrolin Fendon Fevor Finimal G 1 G-1 Gelocatil Hedex Homoolan Injectapap Janupap Korum Lestemp Liquagesic Lonarid Lyteca Lyteca Syrup Multin N-(4-Hydroxyphenyl)acetamide N-Acetyl-4-aminophenol N-Acetyl-p-aminophenol NAPA NAPAP NCI-C55801 NSC3991 Napafen Naprinol Nealgyl Nebs Neotrend Nobedon Pacemo Painex Panadol Panets Paracet Paracetamol Paracetamol DC Paracetamole Paracetanol Parapan Parmol Pedric Phendon Phenol, p-acetamido- Prompt
pdb file: 53438.pdb sdf file: 53438.sdf directory: 53438

131-69-1 4'-(Acetylsulfamoyl)phthalanilic acid 4'-(Acetylsulfamyl)phthalanilic acid Benzoic acid, 2-[[[4-[(acetylamino)sulfonyl]phenyl]amino]carbonyl]- Enterocid Enterosulfamid Enterosulfon Enterosulphamid Ftalicetimida Kalacet N(sup1)-Acetyl-N(sup4)-phthalylsulfanilamide N-(o-Carboxybenzoyl)sulfacetamide NSC4368 Phthalanilic acid, 4'-(acetylsulfamoyl)- Phthaloylsulfacetamide Phthalylsulfacetamide Phthalylsulfacetimide Phthalylsulphacetamide Phthalylthioacetamide Rabalan Sterathal Sulphalyl TSC-80 TSC-80 Medicated Talasulfa Talecid Talicetimida Talsigel Talsutin Tamid Thalajen Thalamyd Thalisul Thalocid
pdb file: 53725.pdb sdf file: 53725.sdf directory: 53725

1-Naphthalenol, 2,4-dinitro- 1-Naphthol, 2,4-dinitro- 2,4-Dinitro-1-naphthol 2,4-Dinitronaphthol 2-4 Dinitro-.alpha.-naphtol 605-69-6 Golden Yellow Manchester Yellow Maritus Yellow Martinsgelb Martius yellow NSC6148 Naphthol Yellow Naphthylene Yellow Saffron Yellow WLN: L66J BQ CNW ENW
pdb file: 55189.pdb sdf file: 55189.sdf directory: 55189

(2,2-Dichloor-vinyl)-dimethyl-fosfaat (2,2-Dichlor-vinyl)-dimethyl-phosphat (2,2-Dichloro-vinil)dimetil-fosfato 0,0-Dimethyl 0-2,2-dichlorovinyl phosphate 2,2-Dichloroethenyl dimethyl phosphate 2,2-Dichlorovinyl dimethyl phosphate 62-73-7 Algard Atgard Atgard C Atgard V BAY-19149 Bibesol Brevinyl Brevinyl E 50 Brevinyl E-50 Canogard Cekusan Chlorvinphos Cyanophos DDVF DDVP DDVP (insecticide) DICHLORVOS Dedevap Dichloorvo Dichlorfos Dichlorman Dichlorophos Dichlorovas Dichlorovos Dichlorphos Dimethyl 2,2-dichloroethenyl phosphate Dimethyl 2,2-dichlorovinyl phosphate Dimethyl O,O-dichlorovinyl-2,2-phosphate Dimethyl dichlorovinyl phosphate Dimethyldichlorovinyl phosphate Divipan ENT-20738 Equigard Equigel Estrosel Ethenol, 2,2-dichloro-, dimethyl phosphate Fecama Fekama Herkal Herkol Krecalvin Lindanmafu Marvex Mopari NCI-C00113 NSC6738 Nerkol Nogos Nogos 50 Nogos G Nuvan Nuvan 100 EC O,O-Dimethyl dichlorovinyl phosphate O,O-Dimethyl-O-(2,2-dichlor-vinyl)-phosphat OKO OMS 14 Phosphate de dimethyle et de 2,2-dichlorovinyle
pdb file: 55749.pdb sdf file: 55749.sdf directory: 55749

.alpha.-Dihydrofucosterol .beta.-Sitosterin .beta.-Sitosterol 22,23-Dihydrostigmasterol 24.alpha.-Ethylcholesterol 83-46-5 Angelicin Angelicin (steroid) Cinchol Cupreol Harzol NSC8096 Quebrachol Rhamnol SITOSTEROL, BETA SKF 14463 Sito-Lande Stigmast-5-en-3-ol, (3.beta.)- Stigmast-5-en-3.beta.-ol Stigmasterol, 22,23-dihydro- Triastonal
pdb file: 56855.pdb sdf file: 56855.sdf directory: 56855

117-39-5 3',4',5,7-Tetrahydroxyflavan-3-ol 3,3',4',5,7-Pentahydroxyflavone 3,5,7,3',4'-Pentahydroxyflavone 4H-1-Benzopyran-4-one, 2-(3,4-dihydroxyphenyl)-3,5,7-trihydroxy- C.I. 75670 C.I. Natural Yellow 10 Cyanidanol Cyanidelonon 1522 Flavone, 3,3',4',5,7-pentahydroxy- Meletin NSC9219 QUERCETIN Quercetine Quercetol Quercitin Quertine Sophoretin WLN: T66 BO EVJ CR CQ DQ & DQ GQ IQ Xanthaurine t-Gelb bzw. grun 1
pdb file: 57788.pdb sdf file: 57788.sdf directory: 57788

1-Oxaspiro[2.5]octan-6-ol, 4-(2,3-epoxy-1,5-dimethyl-4-hexenyl)-5-methoxy- Alcohol-I from Fumagillin Alcohol-I from funagillin FUMAGILLIN, ALCOHOL I ORIGIN Gelcohol NSC9665
pdb file: 75071.pdb sdf file: 75071.sdf directory: 75071

1-(Phenylazo)-2-naphthalenol 1-(Phenylazo)-2-naphthol 1-Benzeneazo-2-naphthol 1-Benzoazo-2-naphthol 1-Phenylazo-.beta.-naphthol 1-Phenylazo-2-naphthol 2-Hydroxy-1-phenylazonaphthalene 2-Hydroxynaphthyl-1-azobenzene 2-Naphthalenol, 1-(phenylazo)- 2-Naphthol, 1-(phenylazo)- 2-Naphtholazobenzene 842-07-9 Atul Orange R Benzene-1-azo-2-naphthol Benzeneazo-.beta.-naphthol Brasilazina Oil Orange Brilliant Oil Orange R C.I. 12055 C.I. Solvent Yellow 14 Calco Oil Orange 7078 Calco Oil Orange 7078-Y Calco Oil Orange Z-7078 Calcogas M Calcogas Orange NC Campbelline Oil Orange Carminaph Ceres Orange R Cerotinorange G Dispersol Yellow PP Dunkelgelb Enial Orange I Fast Oil Orange Fast Oil Orange I Fast Orange Fat Orange 4A Fat Orange G Fat Orange I Fat Orange R Fat Orange RS Fat Soluble Orange Fettorange 4a Fettorange R Fettorange lg Grasal
pdb file: 76262.pdb sdf file: 76262.sdf directory: 76262

1314-23-4 C.I. 77990 NSC12958 Pigment White 12 Rhuligel Zirconia Zirconic anhydride Zirconium White Zirconium dioxide Zirconium oxide Zirconium oxide (ZrO2) Zirox Zt 35
pdb file: 77544.pdb sdf file: 77544.sdf directory: 77544

.alpha.-Dihydrofucosterol .beta.-Sitosterin .beta.-Sitosterol 22,23-Dihydrostigmasterol 24.alpha.-Ethylcholesterol 83-46-5 Angelicin Angelicin (steroid) Cinchol Cupreol Harzol NSC18173 Quebrachol Rhamnol SKF 14463 Sito-Lande Stigmast-5-en-3-ol, (3.beta.)- Stigmast-5-en-3.beta.-ol Stigmasterol, 22,23-dihydro- Triastonal
pdb file: 81307.pdb sdf file: 81307.sdf directory: 81307

76-25-5 9.alpha.-Fluoro-11.beta.,21-dihydroxy-16.alpha.-isopropylidenedioxy-1,4-pregnadiene,3,20-dione 9.alpha.-Fluoro-16-hydroxyprednisolone acetonide 9.alpha.-Fluoro-16.alpha.-17.alpha.-isopropyledenedioxyprednisolone 9.alpha.-Fluoro-16.alpha.-17.alpha.-isopropylidenedioxy-.delta.-1-hydrocortisone 9.alpha.-Fluoro-16.alpha.-hydroxyprednisolone 16.alpha.,17.alpha.-acetonide Adcortyl A Aristocort Acetonide Aristoderm Aristogel Coupe-A Flutone Kenacort-A Kenalog Kenalone NSC21916 Omcilon A Polcortolon Pregna-1,4-diene-3,20-dione, 9-fluoro-11,21-dihydroxy-16,17-[(1-methylethylidene)bis(oxy)]-, (11.beta.,16.alpha.)- Pregna-1,4-diene-3,20-dione, 9-fluoro-11.beta.,16.alpha.,17,21-tetrahydroxy-, cyclic 16,17-acetal with acetone Pregna-1,4-diene-3,20-dione, 9-fluoro-11.beta.,16.alpha.,17,21-tetrahydroxy-,cyclic 16,17-acetal with acetone Pregna-1,4-diene-3,20-dione, 9-fluoro-11.beta.,21-dihydroxy-16.alpha.,17-(isopropylidenedioxy)- Rineton Solodelf Tramacin Triaceton Triam-Injekt Triamcincolone acetonide Triamcinolone 16,17-acetonide Triamcinolone acetonide Tricinolon Vetalog Volon A Volon A 40 WLN: T F5 E5 B666 GO IO RV AHTTTT&J A1 BF CQ E1 FV1Q H1 H1
pdb file: 84206.pdb sdf file: 84206.sdf directory: 84206

1,3-Benzodioxole-5-carboxaldehyde 120-57-0 3,4-(Methylenedioxy)benzaldehyde 3,4-Bis(methylenedioxy)benzaldehyde 3,4-Dihydroxybenzaldehyde methylene ketal 5-Formyl-1,3-benzodioxole Benzaldehyde, 3,4-(methylenedioxy)- Dioxymethylene-protocatechuic aldehyde Geliotropin Heliotropin Heliotropine NSC26826 PIPERONAL Piperonaldehyde Piperonylaldehyde Protocatechuic aldehyde methylene ether WLN: T56 BO DO CHJ GVH
pdb file: 87578.pdb sdf file: 87578.sdf directory: 87578

2-Butenoic acid, 2-methyl-, 7-[[2,3-dihydroxy-2-(1-methoxyethyl)-3-methyl-1-oxobutoxy]methyl]-2,3,5,7a-tetrahydro-1H-pyrrolizin-1-yl ester, [1S-[1.alpha.(Z),7(2S*,3R*),7a.alpha.]]- 303-34-4 Heliotridine ester with lasiocarpum & angelic acid LASIOCARPINE NCI-C01478 NSC30625 WLN: T55 AN CUTJ D1OVXQXQ1 & 1 & Y1 & O1 FOVY1 & U2
pdb file: 89767.pdb sdf file: 89767.sdf directory: 89767

1,6-Heptadiene-3,5-dione, 1,7-bis(4-hydroxy-3-methoxyphenyl)- 458-37-7 C.I. 75300 C.I. Natural Yellow 3 CURCUMIN Curcuma Diferuloylmethane Gelbwurz Haidr Halad Haldar Halud Indian Saffron Kacha Haldi Merita Earth NSC32982 Safran d'Inde Souchet Terra Merita Tumeric yellow Turmeric Turmeric yellow WLN: 1OR BQ E1U1V1V1U1R DQ CO1 Yellow Ginger Yellow Root Yo-Kin
pdb file: 91276.pdb sdf file: 91276.sdf directory: 91276

.alpha.-Dihydrofucosterol .beta.-Sitosterin .beta.-Sitosterol 22,23-Dihydrostigmasterol 24.alpha.-Ethylcholesterol 83-46-5 Angelicin Angelicin (steroid) Cinchol Cupreol Harzol NSC49083 Quebrachol Rhamnol SITOSTEROL, BETA SKF 14463 Sito-Lande Stigmast-5-en-3-ol, (3.beta.)- Stigmast-5-en-3.beta.-ol Stigmasterol, 22,23-dihydro- Triastonal
pdb file: 101391.pdb sdf file: 101391.sdf directory: 101391

1-(Phenylazo)-2-naphthalenol 1-(Phenylazo)-2-naphthol 1-Benzeneazo-2-naphthol 1-Benzoazo-2-naphthol 1-Phenylazo-.beta.-naphthol 1-Phenylazo-2-naphthol 2-Hydroxy-1-phenylazonaphthalene 2-Hydroxynaphthyl-1-azobenzene 2-Naphthalenol, 1-(phenylazo)- 2-Naphthol, 1-(phenylazo)- 2-Naphtholazobenzene 842-07-9 Atul Orange R Benzene-1-azo-2-naphthol Benzeneazo-.beta.-naphthol Brasilazina Oil Orange Brilliant Oil Orange R C.I. 12055 C.I. Solvent Yellow 14 Calco Oil Orange 7078 Calco Oil Orange 7078-Y Calco Oil Orange Z-7078 Calcogas M Calcogas Orange NC Campbelline Oil Orange Carminaph Ceres Orange R Cerotinorange G Dispersol Yellow PP Dunkelgelb Enial Orange I Fast Oil Orange Fast Oil Orange I Fast Orange Fat Orange 4A Fat Orange G Fat Orange I Fat Orange R Fat Orange RS Fat Soluble Orange Fettorange 4a Fettorange R Fettorange lg Grasal
pdb file: 102889.pdb sdf file: 102889.sdf directory: 102889

3',N,N-Trimethyl-4-aminoazobenzene 3'-MDAB 3'-Me-dab 3'-Methyl-4-dimethylaminoazobenzen 3'-Methyl-4-dimethylaminoazobenzene 3'-Methylbuttergelb 3'-Methyldimethylaminoazobenzol 3'Methyl-dab 3-Methyl-4'-(dimethylamino)azobenzene 4-(N,N-Dimethylamino)-3'-methylazobenzene 4-Dimethylamino-3'-methylazobenzene 55-80-1 Aniline, N,N-dimethyl-p-(m-tolylazo)- Benzenamine, N,N-dimethyl-4-[(3-methylphenyl)azo]- MDAB N,N-Dimethyl-p-(m-tolylazo)aniline NSC59783 WLN: 1N1&R DNUNR C1 m'-Methyl-p-dimethylaminoazobenzene
pdb file: 107867.pdb sdf file: 107867.sdf directory: 107867

50-14-6 9,10,Secoergosta-5,7,10(19),22-tetraen 3.beta.-ol 9,10-Secoergosta-5,7,10(19),22-tetraen-3-ol, (3.beta.,5Z,7E,22E)- Buco-D Calciferol Calciferol (vitamin D2) Calciferon 2 Condacaps Condocaps Condol Crtron Crystallina D-Arthin Daral Davitamon D Davitin Decaps Dee-Osterol Dee-Ron Dee-Ronal Dee-Roual Deltalin Deratol Detalup Diactol Divit urto Doral Drisdol ERGOCALCIFEROL Ergorone Ergosterol activated Ergosterol, irradiated Ertron Fortodyl Geltabs Hi-Deratol Infron Irradiated ergosta-5,7,22-trien-3.beta.-ol Metadee Mulsiferol Mykostin NSC62792 Novovitamin-D Oleovitamin D Oleovitamin D2 Ostelin Radiostol Radsterin Shock-ferol Synthetic Vitamin D Vigantol Viostdrol Viosterol Vitamin D Vitamin D2 Vitavel-D WLN: L56 FYTJ A1 BY1&1U1Y1&Y1&1 FU2U- BL6YYTJ AU1 DQ component of Geltabs Vitamin D component of Haliver
pdb file: 109791.pdb sdf file: 109791.sdf directory: 109791

7096-96-0 GELSEDINE NSC71050 Spiro[3H-indole-3,7'(6'H)-[3,6]methano[1H]oxepino[4,3-b]pyrrol]-2(1H)-one, 2'-ethyl-2',3',3'a,4',8',8'a-hexahydro-1-methoxy- Spiro[3H-indole-3,7'(6'H)-[3,6]methano[1H]oxepino[4,3-b]pyrrol]-2(1H)-one, 2'-ethyl-2',3',3'a,4',8',8'a-hexahydro-1-methoxy-, [2'R-(2'.alpha.,3'.alpha.,3'a.beta.,6'.alpha.,7'.alpha.,8'a.beta.)]-
pdb file: 114188.pdb sdf file: 114188.sdf directory: 114188

NSC210752 n-Octyloxime of formylgeldanamycin
pdb file: 126421.pdb sdf file: 126421.sdf directory: 126421

19-Formylgeldanamycin tert-butylimine 62177-10-0 NSC210753
pdb file: 126422.pdb sdf file: 126422.sdf directory: 126422

Geldampicin Geldanaldehyde 1-amino-4-methylpiperazine hydrazone Geldanamycin, rifamycin analog NSC210754
pdb file: 126423.pdb sdf file: 126423.sdf directory: 126423

62177-23-5 8'-Chlorodemethoxygeldanoxazone NSC210756
pdb file: 126425.pdb sdf file: 126425.sdf directory: 126425

30674-68-1 Methyl geldanamycinate NSC212519
pdb file: 127774.pdb sdf file: 127774.sdf directory: 127774

62177-22-4 8'-Bromodemethoxy geldanoxazone 8'-Bromodemethoxygelanoxazone 8-Bromodemethoxygeldanoxazone NSC240006
pdb file: 134354.pdb sdf file: 134354.sdf directory: 134354

17-Des-O-methylgeldanamycin 17-Desmethylgeldanamycin 52762-28-4 Des-O-methylgeldanamycin GELDANAMYCIN ANALOG NSC255104
pdb file: 138252.pdb sdf file: 138252.sdf directory: 138252

64202-83-1 7'-Bromodemethoxy geldanoxazone 7'-Bromodemethoxygeldanoxazone GELDANAMYCIN ANALOG NSC255105
pdb file: 138253.pdb sdf file: 138253.sdf directory: 138253

6'-Bromodemethoxy geldanoxazone 6'-Bromodemethoxygeldanoxazone 64202-82-0 NSC255106
pdb file: 138254.pdb sdf file: 138254.sdf directory: 138254

30562-36-8 GELDANAMYCIN ANALOG Geldanamycin acetate NSC255107
pdb file: 138255.pdb sdf file: 138255.sdf directory: 138255

30562-35-7 Hydrogeldanamycin 18,21-diacetate Hydrogeldanamycin-18,21-diacetate NSC255108
pdb file: 138256.pdb sdf file: 138256.sdf directory: 138256

19-Formylgeldanamycin N',N'-dimethyl-hydrazone 19-Formylgeldanamycin-N',N'-dimethylhydrazone 65764-46-7 NSC255110
pdb file: 138257.pdb sdf file: 138257.sdf directory: 138257

19-Formylgeldanamycin N-piperidinoimine 19-Formylgeldanamycin-N',N'-pentamethylenehydrazone 65764-44-5 NSC255111
pdb file: 138258.pdb sdf file: 138258.sdf directory: 138258

19-Formylgeldanamycin N-morpholinoimine 19-Formylgeldanamycin-N-aminomorpholine adduct 65764-43-4 NSC255112
pdb file: 138259.pdb sdf file: 138259.sdf directory: 138259

19-Formylgeldanamycin N',N'-hexamethylenehydrazone 65764-45-6 NSC260175
pdb file: 138779.pdb sdf file: 138779.sdf directory: 138779

19-Formylgeldanamycin N',N'-di-n-hexylhydrazone 65764-48-9 NSC260176
pdb file: 138780.pdb sdf file: 138780.sdf directory: 138780

(2S-trans)-Toxyl angelate NSC282185 TOXYL ANGELATE
pdb file: 143663.pdb sdf file: 143663.sdf directory: 143663

GEL-I-195-1 NSC283834
pdb file: 143896.pdb sdf file: 143896.sdf directory: 143896

15,16-Dinortricotheca-6,8,10-triene, 12,13-epoxy-8-methoxy-, (12.alpha.-) GEL-I-216-1 NSC283835
pdb file: 143897.pdb sdf file: 143897.sdf directory: 143897

2-Butenoic acid, 2-methyl-, 2,3,3a,4,5,7,9a,9b-octahydro-3,6,9-trimethyl-2,7-dioxoazuleno[4,5-b]furan-3,4-diyl ester, [3R-[3.alpha.(Z),3a.beta.,4.beta.(Z),9a.beta.,9b.alpha.]]- 33439-66-6 4-Angeloyloxypruteninone Guaia-1(10),3-dien-12-oic acid, 6.alpha.,8,11-trihydroxy-2-oxo-, 12,6-lactone, bis(2-methylcrotonate), (Z,Z)-(8S,11R)- NSC292658 PRUTENINONE, 8-ANGELOYLOXY
pdb file: 145764.pdb sdf file: 145764.sdf directory: 145764

(11beta,16alpha)-9-Fluoro-11,17,21-trihydroxy-16-methylpregna-1,4-diene-3,20-dione 1-Dehydro-16-alpha-methyl-9-alpha-fluorohydrocortisone 1-Dehydro-16alpha-methyl-9alpha-fluorohydrocortisone 137098-19-2 16-alpha-Methyl-9-alpha-fluoro-1,4-pregnadiene-11-beta,17-alpha,21-triol-3,20-dione 16-alpha-Methyl-9-alpha-fluoro-1-dehydrocortisol 16-alpha-Methyl-9-alpha-fluoro-11-beta,17-alpha,21-trihydroxypregna-1,4-diene-3,20-dione 16-alpha-Methyl-9-alpha-fluoro-delta(sup 1)-hydrocortisone 16-alpha-Methyl-9-alpha-fluoro-delta1-hydrocortisone 16-alpha-Methyl-9-alpha-fluoroprednisolone 16alpha-Methyl-9alpha-fluoro-1-dehydrocortisol 16alpha-Methyl-9alpha-fluoro-delta(sup 1)-hydrocortisone 16alpha-Methyl-9alpha-fluoroprednisolone 4-alpha-Fluoro-16-alpha-methyl-11-beta,17,21-trihydroxypregna-1,4-diene-3,20-dione 50-02-2 8054-59-9 9-Fluoro-11-beta,17,21-trihydroxy-16-alpha-methylpregna-1,4-diene-3,20-dione 9-Fluoro-11beta,17,21-trihydroxy-16alpha-methylpregna-1,4-diene-3,20-dione 9-alpha-Fluoro-16-alpha-methyl-1,4-pregnadiene-11-beta,17-alpha,21-triol-3,20-dione 9-alpha-Fluoro-16-alpha-methylprednisolone 9alpha-Fluoro-16alpha-methylprednisolone AI3-50934 Aeroseb-D Aeroseb-Dex Anaflogistico Aphtasolon Auxiron Azimycin (Veterinary) Azium Azium (Veterinary) Bisu DS CCRIS 7067 Calonat Corsone Cortisumman DEXAMETHASONE DRG-0013 DXM DXMS Decacortin Decaderm Decadron Decadron Tablets, Elixir Decagel Decalix Decasone Decaspray Dectancyl Dekacort Deltafluorene Dergramin Deronil Desadrene Desametasone Desametasone [DCIT] Desamethasone Desameton Deseronil Dex-ide Dexa Mamallet Dexa-Cortidelt Dexa-Cortisyl Dexa-Scheroson Dexa-sine Dexacidin Dexacort Dexacortal Dexacortin Dexadeltone Dexafarma Dexalona Dexametasona [INN-Spanish] Dexameth Dexamethasone [BAN:INN:JAN] Dexamethasone alcohol Dexamethasone sodium phosphate Dexamethasonum [INN-Latin] Dexamethazone Dexapolcort Dexapos Dexaprol Dexason Dexasone
pdb file: 148518.pdb sdf file: 148518.sdf directory: 148518

(+)-Vitamin D2 (3-beta,5Z,7E,22E)-9,10-Secoergosta-5,7,10,(19),22-tetraen-3-ol 31316-19-5 50-14-6 7489-18-1 8017-28-5 9,10-Seco(5Z,7E,22E)-5,7,10(19),22-ergostatetraen-3-ol 9,10-Secoergosta-5,7,10(19),22-tetraen-3-beta-ol 9,10-Secoergosta-5,7,10(19),22-tetraen-3-ol, (3beta,5Z,7E,22E)- Activated ergosterol Buco-D Calciferol Calciferolum Calciferon 2 Condocaps Condol Crystallina Cycloheanol, 4-methylene-3-(2-(tetrahydro-7a-methyl-1-(1,4,5-trimethyl-2-hexenyl)-4(3aH)-indanylidene)ethylidene)- D-Arthin D-Tracetten Daral Davitamon D Davitin De-rat concentrate Decaps Dee-Osterol Dee-Ron Dee-Ronal Dee-Roual Deltalin Deratol Detalup Diactol Divit urto Doral Drisdol EINECS 200-014-9 Ergocalciferol Ergocalciferol [BAN:INN:JAN] Ergocalciferolo [DCIT] Ergocalciferolum [INN-Latin] Ergorone Ertron Fortodyl Geltabs Geltabs Vitamin D HI-Deratol HSDB 819 Haliver Hyperkil Infron Irradiated ergosta-5,7,22-trien-3-beta-ol Metadee Mina D2 Mulsiferol Mykostin NSC 62792 Novovitamin-D Oleovitamin D2 Ostelin Radiostol Radsterin Rodine C Rodinec Shock-ferol Sorex C.R. Sterogyl VITAMIN D2 Vigantol Vio-D Viosterol Vitavel-D
pdb file: 148528.pdb sdf file: 148528.sdf directory: 148528

1,3,5-Estratriene-3,17-beta-diol 17-beta-Estra-1,3,5(10)-triene-3,17-diol 17-beta-OH-estradiol 17-beta-OH-oestradiol 17-beta-Oestra-1,3,5(10)-triene-3,17-diol 17beta-Estradiol 17beta-Oestra-1,3,5(10)-triene-3,17-diol 3,17-Epidihydroxyestratriene 3,17-Epidihydroxyoestratriene 3,17-beta-Dihydroxy-1,3,5(10)-oestratriene 3,17-beta-Dihydroxyestra-1,3,5(10)-triene 3,17-beta-Dihydroxyoestra-1,3,5-triene 3,17-beta-Estradiol 3,17-beta-Oestradiol 3,17beta-Dihydroxyestra-1,3,5-triene 3,17beta-Dihydroxyoestra-1,3,5-triene 50-28-2 Activella Aerodiol Alora Altrad Aquadiol Bardiol Beta-estradiol CCRIS 280 Climaderm Climara Climara Forte Climara Pro Combipatch Compudose Compudose 200 Compudose 365 Corpagen D-3,17-beta-Estradiol D-3,17-beta-Oestradiol D-3,17beta-Estradiol D-3,17beta-Oestradiol D-Estradiol D-Oestradiol Dermestril Dihydrofollicular hormone Dihydrofolliculin Dihydromenformon Dihydrotheelin Dihydroxyestrin Dihydroxyoestrin Dimenformon Diogyn Diogynets Divigel E(sub 2) EINECS 200-023-8 ESTRADIOL Encore Estra-1,3,5(10)-triene-3,17-beta-diol Estra-1,3,5(10)-triene-3,17-diol, (17beta)- Estra-1,3,5(10)-triene-3,17beta-diol Estrace Estraderm Estraderm MX Estraderm TTS Estraderm TTS 50 Estradiol [USAN:INN] Estradiol-17-beta Estradiol-17beta Estradiol-3,17beta Estradiolo [DCIT] Estradiolum [INN] Estraldine Estrapak 50 Estrasorb Estreva Estrifam Estring Estroclim 50 Estrodiolum [INN-Latin] Estrofem 2 Estrofem
pdb file: 148536.pdb sdf file: 148536.sdf directory: 148536

162222-91-5 165659-51-8 4-01-00-04302 (Beilstein Handbook Reference) 50-99-7 50933-92-1 8012-24-6 80206-31-1 8030-23-7 AI3-09328 Anhydrous dextrose BRN 1724615 Blood sugar CCRIS 950 Cartose Cerelose Cerelose 2001 Corn sugar D(+)-Glucose D-Glucose D-Glucose, anhydrous Dextropur Dextrose Dextrose solution Dextrose, anhydrous Dextrosol EINECS 200-075-1 GLUCOSE Glucolin Glucose liquid Glucose solution Glucose, anhydrous Glucosteril Goldsugar Grape sugar HSDB 489 Maxim Energy Gel NSC 406891 Sirup Staleydex 111 Staleydex 333 Sugar, grape Tabfine 097(HS) Traubenzucker Vadex alpha-D-Glucopyranose
pdb file: 148583.pdb sdf file: 148583.sdf directory: 148583

2(3H)-Furanone, 3-ethyldihydro-4-((1-methyl-1H-imidazol-5-yl)methyl)-, monohydrochloride, (3S,4R)- 2(3H)-Furanone, 3-ethyldihydro-4-((1-methyl-1H-imidazol-5-yl)methyl)-, monohydrochloride, (3S-cis)- 54-71-7 AI3-61859 Adsorbocarpine Almocarpine Ami-pilo Amistura P E-Pilo EINECS 200-212-5 Epicar Isopto P-ES Isopto-carpine MI-Pilo Ophth Sol Mistura P NSC 5746 PILOCARPINE, MONOHYDROCHLORIDE Pilocar Pilocar SMP Pilocarpal Pilocarpine hydrochloride Pilocarpine hydrochloride [USAN:JAN] Pilocarpine monohydrochloride Pilocarpine muriate Pilocarpine, hydrochloride Pilocel Pilokarpin monohydrochloride Pilomiotin Pilopine HS Gel Pilovisc Salagen Sno pilo Spersacarpine hydrochloride
pdb file: 148721.pdb sdf file: 148721.sdf directory: 148721

(-)-3,4-Dihydroxy-alpha-((methylamino)methyl)benzyl alcohol hydrochloride (R)-4-(1-Hydroxy-2-(methylamino)ethyl)pyrocatechol hydrochloride 1,2-Benzenediol, 4-(1-hydroxy-2-(methylamino)ethyl)-, hydrochloride, (R)- (9CI) 1-Epinephrine hydrochloride 329-63-5 39836-34-5 4-(1-Hydroxy-2-(methylamino)ethyl)-1,2-benzenediol hydrochloride 55-31-2 66240-90-2 Adrenalin chloride Adrenalin hydrochloride Adrenaline chloride Adrenaline hydrochloride Benzyl alcohol, 3,4-dihydroxy-alpha-((methylamino)methyl)-, hydrochloride, (-)- CCRIS 2368 EINECS 200-230-3 EPINEPHRINE SALT (HCL) Epinephrine chloride Epinephrine hydrochloride Epinephrine, hydrochloride Gelatin-epinephrine L-Epinephrine hydrochloride NCI-C55663 Supranephrin solution Suprarenin hydrochloride l-1-(3,4-Dihydroxyphenyl)-2-methylamino-1-ethanol hydrochloride l-Adrenaline chloride l-Adrenaline hydrochloride l-Epinephrine chloride l-Methylaminoethanolcathechol hydrochloride
pdb file: 148739.pdb sdf file: 148739.sdf directory: 148739

1,2,3-Propanetriol, trinitrate 1,2,3-Propanetriyl nitrate 105469-31-6 4-01-00-02762 (Beilstein Handbook Reference) 55-63-0 80066-48-4 8013-23-8 9010-02-0 Adesitrin Aldonitrin Angibid Anginine Angiolingual Angiplex Anglix Angonist Angorin Aquo-Trimitrosan BRN 1802063 Blasting gelatin Blasting oil Buccard CCRIS 4089 Cardabid Cardamist Cardinit Cardiodisco Chitamite Colenitral Corangin Nitrokapseln Cordipatch Corditrine Coro-Nitro Dauxona Deponit Deponit 5 Deponit TTS 10 Deponit TTS 5 Deponit-5 Diafusor Discotrine EINECS 200-240-8 Epinitril GTN GTN-Pohl Gepan Nitroglicerin Gilucor nitro Gilustenon Glonoin Glycerintrinitrate [Czech] Glycerol (trinitrate de) [French] Glycerol trinitrate Glycerol(trinitrate de) [French] Glycerol, nitric acid triester Glyceroltrinitraat [Dutch] Glyceryl Glyceryl nitrate Glyceryl trinitrate Glycerylnitrat Glytrin HSDB 30 Herwicard Herzer Klavikordal Lenitral Lentonitrina Mi-Trates
pdb file: 148749.pdb sdf file: 148749.sdf directory: 148749

55-68-5 BRN 3945322 Caswell No. 657I EINECS 200-242-9 EPA Pesticide Chemical Code 066016 Fenylmerkurinitrat [Czech] HSDB 2506 Mercuriphenyl nitrate Mercury, (nitrato-O)phenyl- Mercury, (nitrato-kappaO)phenyl- Mercury, nitratophenyl- Merpectogel Merphenyl nitrate Mersolite 7 NSC 4772 Nitratophenylmercury Nitric acid, phenylmercury salt PHENYLMERCURIC NITRATE Phe-Mer-Nite Phenalco Phenitol Phenmerzyl Nitrate Phenylmercuric nitrate [UN1895] [Poison] Phenylmercuric nitrate, basic Phenylmercurinitrate Phenylmercury nitrate Phenylmercury(II) nitrate Phermernite UN1895
pdb file: 148751.pdb sdf file: 148751.sdf directory: 148751

3',N,N-Trimethyl-4-aminoazobenzene 3'-Mdab 3'-Me-Dab 3'-Methyl-4-(N,N-dimethylamino)azobenzene 3'-Methyl-4-(dimethylamine)azobenzene 3'-Methyl-4-(dimethylamino)azobenzene 3'-Methyl-4-dimethylaminoazobenzen [Czech] 3'-Methyl-4-dimethylaminoazobenzene 3'-Methyl-N,N-dimethyl-4-aminoazobenzene 3'-Methyl-dab 3'-Methylbuttergelb [German] 3'-Methyldimethylaminoazobenzol [German] 3-METHYL-4'-(DIMETHYLAMINO)AZOBENZENE 4-(N,N-Dimethylamino)-3'-methylazobenzene 4-16-00-00487 (Beilstein Handbook Reference) 4-Dimethylamino-3'-methylazobenzene 55-80-1 AI3-50459 Aniline, N,N-dimethyl-p-(3'-methylphenylazo)- Aniline, N,N-dimethyl-p-(m-tolylazo)- BRN 0747123 Benzenamine, N,N-dimethyl-4-((3-methylphenyl)azo)- CCRIS 1131 EINECS 200-243-4 HSDB 5071 MDAB Methyldimethylaminoazobenzene N,N-Dimethyl-4-((3-methylphenyl)azo)benzenamine N,N-Dimethyl-4-(m-tolylazo)aniline N,N-Dimethyl-p-(m-tolylazo)aniline NSC 59783 m'-Methyl-p-dimethylaminoazobenzene
pdb file: 148753.pdb sdf file: 148753.sdf directory: 148753

15743-44-9 17829-66-2 2-Aminoacetic acid 29728-27-6 32817-15-5 33242-26-1 35947-07-0 513-29-1 52955-63-2 56-40-6 57678-19-0 6000-43-7 6000-44-8 63183-41-5 71295-98-2 7490-95-1 87867-94-5 AI3-04085 Acetic acid, amino- Acide aminoacetique [INN-French] Acido aminoacetico [INN-Spanish] Acidum aminoaceticum [INN-Latin] Aciport Aminoacetic acid Aminoazijnzuur Aminoethanoic acid Amitone CCRIS 5915 Corilin EINECS 200-272-2 FEMA No. 3287 GLY (IUPAC abbrev) GLYCINE Glicina [INN-Spanish] Glicoamin Glycin Glycine [INN] Glycine iron sulphate (1:1) Glycine, non-medical Glycinum [INN-Latin] Glycocoll Glycolixir Glycosthene HSDB 495 Hampshire glycine L-Glycine Leimzucker NSC 25936 Padil Sucre de gelatine
pdb file: 148775.pdb sdf file: 148775.sdf directory: 148775

17alpha-Hydroxy-6alpha-methylpregn-4-ene-3,20-dione 17alpha-Progesterone 257630-50-5 3,20-Pregnene-4 4-Pregnene-3,20-dione 57-83-0 6alpha-Methylpregn-4-en-17alpha-ol-3,20-dione 753497-20-0 8012-32-6 8023-13-0 AI3-51682 Agolutin Bio-luton CCRIS 533 Corlutin Corlutina Corluvite Corporin Corpus luteum hormone Crinone Crinone progesterone gel Cyclogest Cyclogesterin EINECS 200-350-6 Flavolutan Fologenon Gesterol Gesterol 100 Gesterol 50 Gestone Gestormone Gestron Glanducorpin Gynlutin Gynoluton Gynolutone HSDB 3389 Hormoflaveine Hormoluton Lingusorbs Lipo-Lutin Lucorteum Lucorteum Sol Luteal hormone Luteinique Luteocrin normale Luteodyn Luteogan Luteohormone Luteol Luteol (VAN) Luteopur Luteosan Luteostab Luteovis Lutex Lutidon Lutin Lutociclina Lutocyclin Lutocyclin M Lutocylin Lutoform Lutogyl Lutren Lutromone Membrettes Methylpregnone NSC 64377 NSC 9704 NSC-9704 Nalutron PROGESTERONE Percutacrine Luteinique Piaponon Pregn-4-ene-3,20-dione Pregn-4-ene-3,20-dione, 17alpha-hydroxy-6alpha-methyl- Pregnene-3,20-dione Pregnenedione Primolut Prochieve
pdb file: 148842.pdb sdf file: 148842.sdf directory: 148842

17-Hydroxy-(17-beta)-androst-4-en-3-one 17-Hydroxy-(17beta)-androst-4-en-3-one 17-beta-Hydroxy-delta(sup 4)-androsten-3-one 17-beta-Hydroxyandrost-4-en-3-one 17beta-Hydroxy-delta(sup4)-androsten-3-one 17beta-Hydroxyandrost-4-en-3-one 17beta-Hydroxyandrost-4-ene-3-one 58-22-0 7-beta-Hydroxyandrost-4-en-3-one 9-beta,10-alpha-ANDROST-4-EN-3-ONE, 17-beta-HYDROXY- AA 2500 Andro 100 AndroGel Androderm Androlin Andronaq Andropatch Androst-4-en-17beta-ol-3-one Androst-4-en-3-one, 17-beta-hydroxy- Androst-4-en-3-one, 17-hydroxy-, (17-beta)- Androst-4-en-3-one, 17-hydroxy-, (17beta)- Androst-4-en-3-one, 17beta-hydroxy- Andrusol CCRIS 574 CDB 111C COL 1621 CP 601B Cristerona T Cristerone T DEA No. 4000 EINECS 200-370-5 Geno-cristaux gremy HSDB 3398 Homosteron Homosterone LibiGel Malerone Malestrone (amps) Malogen, aquaspension injection Mertestate NSC 9700 Neo-Hombreol F Neo-testis Neotestis Oreton Oreton-F Orquisteron Perandren Percutacrine androgenique Primotest Primoteston Relibra Sustanon Sustanone Sustason 250 Synandrol F Teslen Testandrone Testex Testiculosterone Testim Testobase Testoderm Testogel Testoject-50 Testopropon Testosteroid Testosteron Testosterona [INN-Spanish]
pdb file: 148861.pdb sdf file: 148861.sdf directory: 148861

(2S,5R,6R)-3,3-Dimethyl-7-oxo-6-(2-phenylacetamido)-4-thia-1-azabicyclo(3.2.0)heptane-2-carboxylic acid (5R,6R)-Benzylpenicillin (Phenylmethyl)penicillin (Phenylmethyl)penicillinic acid 113-98-4 4-27-00-05861 (Beilstein Handbook Reference) 4-Thia-1-azabicyclo(3.2.0)heptane-2-carboxylic acid, 3,3-dimethyl-7-oxo-6- (2-phenylacetamido)- 4-Thia-1-azabicyclo(3.2.0)heptane-2-carboxylic acid, 3,3-dimethyl-7-oxo-6-((phenylacetyl)amino)- (2S-(2alpha,5alpha,6beta))- 4-Thia-1-azabicyclo(3.2.0)heptane-2-carboxylic acid, 3,3-dimethyl-7-oxo-6-((phenylacetyl)amino)-, (2S-(2alpha,5alpha,6beta))- 4-Thia-1-azabicyclo(3.2.0)heptane-2-carboxylic acid, 3,3-dimethyl-7-oxo-6-(2-phenylacetamido)- 4-Thia-1-azabicyclo(3.2.0)heptane-2-carboxylic acid, 3,3-dimethyl-7-oxo-6-(2-phenylacetamido)- (8CI) 6-(2-Phenylacetamido)penicillanic acid 61-33-6 69-57-8 Abbocillin BRN 0044740 Bencilpenicilina [Spanish] Benzopenicillin Benzyl penicillin Benzyl-6-aminopenicillinic acid Benzylpenicillin Benzylpenicillin G Benzylpenicillin [BAN:INN] Benzylpenicilline [French] Benzylpenicillinic acid Benzylpenicillinum [Latin] Cilloral Cilopen Compocillin G Cosmopen Dropcillin EINECS 200-506-3 Free benzylpenicillin Free penicillin G Free penicillin II Galofak Gelacillin HSDB 3166 Liquacillin NSC 193396 PENICILLIN G Pencillin G Penicillin penicillin G Penicillin, (phenylmethyl)- Penicillinic acid, (phenylmethyl)- Penicillinic acid, benzyl- Pharmacillin Phenylacetamidopenicillanic acid Pradupen Specilline G
pdb file: 148974.pdb sdf file: 148974.sdf directory: 148974

1-Acetamido-4-ethoxybenzene 4-13-00-01092 (Beilstein Handbook Reference) 4-Ethoxyacetanilide 62-44-2 AI3-00783 Acet-p-phenalide Acetamide, N-(4-ethoxyphenol)- Acetamide, N-(4-ethoxyphenyl)- Acetanilide, 4'-ethoxy- Acetic acid amide, N-(4-ethoxyphenyl)- Aceto-4-phenetidine Aceto-para-phenalide Aceto-para-phenetidide Acetophenetidin Acetophenetidine Acetophenetin Acetphenetidin Acetylphenetidin Achrocidin Anapac BRN 1869238 Bromo seltzer Buff-A-Comp CCRIS 496 Citra-fort Clistanol Codempiral Commotional Contradol Contradouleur Coricidin Coriforte Coryban-D Daprisal Darvon compound Dasikon Dasin Dasin CH Dolostop EINECS 200-533-0 Edrisal Empiral Emprazil Emprazil-C Epragen Fenacetin [Czech] Fenacetina Fenacetina [INN-Spanish] Fenia Fenidina Fenina Fiorinal Fortacyl Gelonida Gewodin HSDB 3152 Helvagit Hjorton's powder Hocophen KAFA Kalmin Malex Melabon Melaforte N-(4-Ethoxyphenyl)acetamide N-Acetyl-p-phenetidine N-Acetyl-para-phenetidine N-para-Ethoxyphenylacetamide NSC 7651 Norgesic P-A-C Compound PHENACETIN Pamprin Paracetophenetidin Paramette Paratodol Pertonal Phenacet
pdb file: 149002.pdb sdf file: 149002.sdf directory: 149002

(+-)-Camphor 0-07-00-00135 (Beilstein Handbook Reference) 1,7,7-Trimethylbicyclo(2.2.1)-2-heptanone 1,7,7-Trimethylbicyclo(2.2.1)heptan-2-one 1,7,7-Trimethylnorcamphor 2-Bornanone 2-Camphanone 2-Kamfanon [Czech] 2-Keto-1,7,7-trimethylnorcamphane 21368-68-3 4-07-00-00213 (Beilstein Handbook Reference) 48113-22-0 76-22-2 8013-55-6 8022-77-3 AI3-18783 Alphanon BRN 1907611 BRN 3196099 Bicyclo(2.2.1)heptan-2-one, 1,7,7-trimethyl- Bornane, 2-oxo- CAMPHOR Campho-Phenique Cold Sore Gel Campho-Phenique Gel Campho-Phenique Liquid Camphor, synthetic Camphor, synthetic [UN2717] [Flammable solid] Caswell No. 155 DL-Bornan-2-one DL-Camphor EINECS 200-945-0 EINECS 244-350-4 EPA Pesticide Chemical Code 015602 Gum camphor HSDB 37 Heet Huile de camphre [French] Kampfer [German] Matricaria camphor Norcamphor, 1,7,7-trimethyl- Root bark oil Sarna Spirit of camphor UN2717
pdb file: 149381.pdb sdf file: 149381.sdf directory: 149381

13586-95-3 138265-06-2 5-19-06-00568 (Beilstein Handbook Reference) 76-25-5 8054-16-8 9-Fluoro-11beta,16alpha,17,21-tetrahydroxypregna-1,4-diene-3,20-dione cyclic 16,17-acetal with acetone 9-alpha-Fluoro-11-beta,21-dihydroxy-16-alpha,17-alpha-isopropylidenedioxypregna-1,4-diene-3,20-dione 9-alpha-Fluoro-11-beta,21-dihydroxy-16-alpha-isopropylidenedioxy-1,4-pregnadiene,3,20-dione 9-alpha-Fluoro-16-alpha-17-alpha-isopropyledenedioxyprednisolone 9-alpha-Fluoro-16-alpha-17-alpha-isopropylidenedioxy-delta-1-hydrocortisone 9-alpha-Fluoro-16-alpha-hydroxyprednisolone 16-alpha,17-alpha-acetonide 9-alpha-Fluoro-16-hydroxyprednisolone acetonide 9alpha-Fluoro-16-hydroxyprednisolone acetonide 9alpha-Fluoro-16alpha-17alpha-isopropyledenedioxyprednisolone Acetospan Adcortyl A Aristocort Aristocort A Aristocort acetonide Aristoderm Aristogel Azmacort BRN 0060069 CCRIS 5231 Coupe-A EINECS 200-948-7 Flutone Kenacort-A Kenalog Kenalone Myco-Triacet II Mycolog II Mytrex NSC 21916 Nasacort Nasacort AQ Nasacort HFA Omcilon A Panolog Ointment (Veterinary) Polcortolon Pregna-1,4-diene-3,20-dione, 9-fluoro-11,21-dihydroxy-16,17-((1-methylethylidene)bis(oxy))-, (11beta,16alpha)- Pregna-1,4-diene-3,20-dione, 9-fluoro-11-beta,16-alpha,17,21-tetrahydroxy-, cyclic 16,17-acetal with acetone Pregna-1,4-diene-3,20-dione, 9-fluoro-11beta,16alpha,17,21-tetrahydroxy-, cyclic 16,17-acetal with acetone (8CI) Rineton Solodelf TAC-3 TRIAMCINOLONE ACETONIDE Tramacin Triacet Triaceton Triam-Injekt Triamcincolone acetonide Triamcinolone 16,17-acetonide Triamcinolone acetonide [JAN] Triamonide 40 Triamsinolone
pdb file: 149383.pdb sdf file: 149383.sdf directory: 149383

1(3H)-Isobenzofuranone, 3,3-bis(4-hydroxyphenyl)- 3,3-Bis(4-hydroxyphenyl)-1(3H)-isobenzofuranone 3,3-Bis(4-hydroxyphenyl)phthalide 3,3-Bis(p-hydroxyphenyl)phthalide 467-29-8 5-18-04-00188 (Beilstein Handbook Reference) 57214-20-7 77-09-8 AI3-09081 Agoral Alophen BRN 0284423 CCRIS 6266 Chocolax Colax Correctol Dihydroxyphthalophenone Doxan Doxidan EINECS 201-004-7 Espotabs Euchessina Evac-Q-Kit Evac-Q-Kwik Evac-Q-Tabs Evac-U-Gen Evac-V-Lax Ex-Lax Feen-A-Mint Gum Feen-A-Mint Laxative Mints FemiLax Fenolftalein [Czech] Fenolftaleina [INN-Spanish] HSDB 4161 Koprol Lax-Pills Laxcaps Laxin Laxogen Lilo Medilax Modane Plus NCI-C55798 NSC 10464 PHENOLPHTHALEIN Phenolax Phenolphtaleine [INN-French] Phenolphthalein [USAN:BAN:INN] Phenolphthaleinum [INN-Latin] Phillips Gelcaps Phthalide 3,3,-bis(p-hydroxyphenyl)- Phthalimetten Phthalin Purga Purgen Purgophen Spulmako-lax Trilax alpha-(p-Hydroxyphenyl)-alpha-(4-oxo-2,5-cyclohexadien-1-ylidene)-o-toluic acid alpha-Di(p-hydroxyphenyl)phthalide
pdb file: 149422.pdb sdf file: 149422.sdf directory: 149422

1-(1-Phenylcyclohexyl)piperidine 2981-31-9 5-20-02-00078 (Beilstein Handbook Reference) 77-10-1 Angel dust Angel hair Angel mist Animal tranquilizer Aurora borealis BRN 1287039 Busy bee CI-395 CJs Cadillac Cl-395 Crystal Crystal joints Cycline Cyclones DEA No. 7471 Dust Elephant tranquilizer Embalming fluid Fenciclidina [INN-Spanish] Good Goon Gorilla biscuits Green tea leaves HOG HSDB 6472 Hog Dust Horse tracks Horse tranquilizer KJ KW Kay Jay Killer weed LBJ Magic mist Mint dew Mint weed Mist Monkey dust Monkey tranquilizer PCP PCP (anesthetic) PHENCYCLIDINE Peace Peace Pill Peace weed Phencyclidinum [INN-Latin] Piperidine, 1-(1-phenylcyclohexyl)- Pits Rocket fuel Scuffle Selma Sheets Sherman Snorts Soma Stardust Super Kool
pdb file: 149423.pdb sdf file: 149423.sdf directory: 149423

102490-55-1 4-04-00-00275 (Beilstein Handbook Reference) 77-81-6 BRN 1769395 CCRIS 3421 Dimethylamidoethoxyphosphoryl cyanide Dimethylaminocyanphosphorsaeureaethylester [German] Dimethylphosphoramidocyanidic acid, ethyl ester EA 1205 Ethyl N,N-dimethylphosphoramidocyanidate Ethyl N-dimethylphosphoramidocyanidate Ethyl dimethylamidocyanophosphate Ethyl dimethylphosphoramido cyanidate Ethyl dimethylphosphoramidocyanidate Ethyl phosphorodimethylamidocyanidate Ethylester-dimethylamid kyseliny kyanfosfonove [Czech] GA GA (chemical warfare agent) Gelan I HSDB 6378 Le-100 Nerve agent O-Ethyl N,N-dimethylphosphoramidocyanidate Phosphoramidocyanidic acid, dimethyl-, ethyl ester T-2104 TABUN TL 1578 Taboon A Trilon 83
pdb file: 149463.pdb sdf file: 149463.sdf directory: 149463

2-Propenamide 4-02-00-01471 (Beilstein Handbook Reference) 79-06-1 AAM ACRYLAMIDE AI3-04119 Acrylagel Acrylamide [UN2074] [Poison] Acrylamide solution Acrylamide solution (50 or less) Acrylic acid amide Acrylic amide Akrylamid [Czech] Amid kyseliny akrylove [Czech] Amresco Acryl-40 BRN 0605349 CCRIS 7 EINECS 201-173-7 Ethylenecarboxamide HSDB 191 NSC 7785 Optimum Propenamide Propeneamide Propenoic acid amide RCRA waste no. U007 RCRA waste number U007 UN2074 Vinyl amide
pdb file: 149545.pdb sdf file: 149545.sdf directory: 149545

(-)-beta-Sitosterol (24R)-Ethylcholest-5-en-3beta-ol (24R)-Stigmast-5-en-3beta-ol (3-beta)-Stigmast-5-en-3-ol (3beta)-Stigmast-5-en-3-ol 15764-35-9 182512-23-8 22,23-Dihydrostigmasterol 24-alpha-Ethylcholesterol 24alpha-Ethylcholesterol 76772-70-8 8003-23-4 83-46-5 AI3-26020 Angelicin Angelicin (VAN) Angelicin (steroid) Azuprostat BETA-SITOSTEROL CCRIS 5529 Cinchol Cupreol EINECS 201-480-6 NSC 18173 NSC 8096 Nimbosterol Quebrachol Rhamnol SKF 14463 Sito-Lande Sobatum Stigmast-5-en-3-beta-ol Stigmast-5-en-3-ol, (3beta)- Stigmast-5-en-3beta-ol Stigmasterol, 22,23-dihydro- Triastonal alpha-Dihydrofucosterol beta-Sitosterin delta5-Stigmasten-3-beta-ol
pdb file: 149727.pdb sdf file: 149727.sdf directory: 149727

1,2-Ethylene glycol monosalicylate 2-Hydroxybenzoic acid, 2-hydroxyethyl ester 2-Hydroxyethyl 2-hydroxybenzoate 2-Hydroxyethyl salicylate 87-28-5 AI3-05033 Aethylenglykolsalicylat Benzoic acid, 2-hydroxy-, 2-hydroxyethyl ester EINECS 201-737-2 Espirosal Ethylene glycol salicylate Ethylene glycol, monosalicylate Ethylene glycol, salicylate Ethylenglycol-monosalicylsaeureester GL 7 GLYCOL SALICYLATE Glycol monosalicylate Glykolsalicylat Glysal Kytta-gel Monoglycol salicylate NSC 72097 Norgesic Phlogont Rheumacyl Salicylic acid, 2-hydroxyethyl ester (8CI) Sarocol Spirosal Traumasenex
pdb file: 149883.pdb sdf file: 149883.sdf directory: 149883

2H-1-Benzopyran-2-one, 7-hydroxy-6-methoxy- (9CI) 5-18-03-00203 (Beilstein Handbook Reference) 6-Methoxy-7-hydroxycoumarin 6-Methylesculetin 6-O-Methylesculetin 7-Hydroxy-6-methoxy-2H-1-benzopyran-2-one 7-Hydroxy-6-methoxycoumarin 92-61-5 BRN 0156296 CCRIS 3592 COUMARIN, 7-HYDROXY-6-METHOXY- Chrysatropic acid EINECS 202-171-9 Escopoletin Esculetin 6-methyl ether Gelseminic acid Murrayetin NSC 405647 Scopoletin Scopoletine Scopoletol beta-Methylesculetin
pdb file: 150133.pdb sdf file: 150133.sdf directory: 150133

117989-71-6 132323-44-5 143928-58-9 37370-29-9 94-36-0 Abcat 40 Acetoxyl Acne-Aid Cream Acnegel Akneroxid 5 Akneroxide L Aksil 5 Asidopan Aztec BPO B 75W BENZOYL PEROXIDE BPO BZF-60 Benbel C Benox 50 Benoxyl Benoxyl (5&10) Lotion Benzac Benzac W Benzagel Benzagel 10 Benzaknen Benzamycin Benzashave Benzoic acid, peroxide Benzol peroxide Benzoperoxide Benzoyl peroxide [USAN] Benzoyl superoxide Benzoylperoxid [German] Benzoylperoxyde [Dutch] Brevoxyl CCRIS 630 Cadat BPO Cadox 40E Cadox B Cadox B 40E Cadox B 50P Cadox B 70W Cadox B-CH 50 Cadox BS Chaloxyd BP 50FT Clear By Design Clearasil Antibacterial Acne Lotion Clearasil BP Acne Treatment Cream Debroxide Desanden Desquam
pdb file: 150230.pdb sdf file: 150230.sdf directory: 150230

(Orthoborato(3-)-O)phenylmercurate(2-), dihydrogen 102-98-7 Boric acid, phenylmercury deriv. Caswell No. 656C Dihydrogen (orthoborato(3-)-O)phenylmercurate(2-) EINECS 203-068-1 EPA Pesticide Chemical Code 066005 Exomycol gel Famosept Fenosept Formasept Mercurate(2-), (orthoborato(3-)-O)phenyl-, dihydrogen Mercurate(2-), (orthoborato(3-)-O)phenyl-, dihydrogen (9CI) Mercurate(2-), (orthoboroato(3-)-O)phenyl, dihydrogen Mercury, (dihydrogen borato)phenyl- Mercury, (dihydrogen orthoborato)phenyl- (8CI) Mercury, (orthoborato(1-)-O)phenyl- Merfen Merphen Metasol BT NSC 163948 PHENYLMERCURIC BORATE PMB PMB (VAN) Phenyl mercuric borate Phenylmercuriborate Phenylmercuric borate (VAN) Phenylmercury borate Ryfen Spidox Spidoxol
pdb file: 150710.pdb sdf file: 150710.sdf directory: 150710

108-95-2 139-02-6 14534-23-7 50356-25-7 8002-07-1 AI3-01814 Acide carbolique [French] Anbesol Baker's P & S liquid & Ointment Baker's P and S Liquid and Ointment Benzene, hydroxy- Benzenol CCRIS 504 Campho-Phenique Cold Sore Gel Campho-Phenique Gel Campho-Phenique Liquid Carbolic acid Carbolic oil Carbolsaure [German] Caswell No. 649 EINECS 203-632-7 EPA Pesticide Chemical Code 064001 FEMA No. 3223 Fenol [Dutch, Polish] Fenolo [Italian] HSDB 113 Hydroxybenzene Izal Liquid phenol Monohydroxybenzene Monophenol NCI-C50124 NSC 36808 Oxybenzene PHENOL Paoscle PhOH Phenic acid Phenol (or solutions with 5 or more phenol) Phenol [JAN] Phenol alcohol Phenol solutions [UN2821] [Poison] Phenol, liquefied Phenol, molten [UN2312]
pdb file: 151081.pdb sdf file: 151081.sdf directory: 151081

1-Methylethyl tetradecanoate 1-Tridecanecarboxylic acid, isopropyl ester 110-27-0 1405-98-7 4-02-00-01132 (Beilstein Handbook Reference) BRN 1781127 Bisomel Caswell No. 511E Crodamol I.P.M. Crodamol IPM Deltyl Extra Deltylextra EINECS 203-751-4 EPA Pesticide Chemical Code 000207 Emcol-IM Emerest 2314 Estergel FEMA No. 3556 HSDB 626 IPM ISOPROPYL MYRISTATE Isomyst Isopropyl tetradecanoate JA-FA IPM Kessco IPM Kessco isopropyl myristate Kesscomir Myristic acid, isopropyl ester Myristic acid, isopropyl ester (8CI) NSC 406280 Plymoutm IPM Promyr Sinnoester MIP Starfol IPM Stepan D-50 Tegester Tetradecanoic acid, 1-methylethyl ester Tetradecanoic acid, isopropyl Tetradecanoic acid, isopropyl ester Unimate IPM Wickenol 101
pdb file: 151160.pdb sdf file: 151160.sdf directory: 151160

(3R*,4S*,5S*,6R*,7R*,9R*,11R*,12R*,13S*,14R*)-4-((2,6-Dideoxy-3-C-methyl-3-O-methyl-alpha-L-ribo-hexopyranosyl)oxy)-14-ethyl-7,12,13-trihydroxy-3,5,7,9,11,13-hexamethyl-6-((3,4,6-trideoxy-3-(dimethylamino)-beta-D-xylo-hexopyranosyl)oxy)oxacyclotetradecane-2,10-dione 114-07-8 374700-25-1 47879-92-5 47879-97-0 47880-49-9 50976-86-8 7540-22-9 AI3-50138 Abboticin Abomacetin Acneryne Acnesol Ak-Mycin Akne Cordes Losung Akne-Mycin Aknederm Ery Gel Aknemycin Aknin AustriaS Benzamycin C-Solve-2 DRG-0279 Del-Mycin Derimer Deripil Dotycin Dumotrycin E-Base E-Base (base) E-Mycin E-Mycin (base) EINECS 204-040-1 ERYC ERYC (base) ERYTHROMYCIN Emgel Emu-V Emu-Ve Emuvin Emycin Endoeritrin Erecin Erimycin-T Erisone Eritomicina Eritrocina Eritromicina Eritromicina [INN-Spanish] Ermycin Eros Ery-B Ery-Diolan Ery-Tab Ery-Tab (base) Ery-maxin EryDerm Eryacne Eryacnen Eryc-125 Eryc-250 Erycen Erycette Erycin Erycinum Erydermer Erygel Eryhexal Erymax Erymed Erysafe Erytab Erythra-Derm Erythro-Teva Erythrocin Erythroderm Erythrogran Erythroguent Erythromast 36 Erythromid Erythromycin A Erythromycin [BAN:INN:JAN] Erythromycin base Erythromycine Erythromycine
pdb file: 151369.pdb sdf file: 151369.sdf directory: 151369

114-26-1 2-(1-Methylethoxy)phenol methylcarbamate 2-Isopropoxyphenyl N-methylcarbamate 2-Isopropoxyphenyl-N-methylcarbamat [German] AI3-25671 Aprocarb BAY 39007 BAY 5122 BRN 1879891 Bay 9010 Bayer 39007 Bayer B 5122 Baygon Bifex Blattanex Blattosep Bolfo Boruho Boruho 50 Brygou CCRIS 1392 Carbamic acid, methyl-, o-isopropoxyphenyl ester Caswell No. 508 Chemagro 9010 Dalf dust EINECS 204-043-8 ENT 25,671 EPA Pesticide Chemical Code 047802 HSDB 603 IPMC Invisi-Gard Isocarb Mrowkozol NSC 379584 O-(2-Isopropoxyphenyl) N-methylcarbamate OMS-33 PHC (carbamate) PHC 7 PROPOXUR Phenol, 2-(1-methylethoxy)-, methylcarbamate Phenol, o-isopropoxy-, methylcarbamate Propoksuru [Polish] Propotox Propoxur [BAN] Propoxure Propoxylor Propyon Rhoden Sendran Suncide Tendex Tugon fliegenkugel Unden (pesticide) Unden 50PM o-IMPC o-Isopropoxyphenyl N-methylcarbamate o-Isopropoxyphenyl methylcarbamate
pdb file: 151373.pdb sdf file: 151373.sdf directory: 151373

117-39-5 3',4',5,7-Tetrahydroxyflavan-3-ol 3,3',4',5,7-Pentahydroxyflavone 3,5,7,3',4'-Pentahydroxyflavone 3,5,7-Trihydroxy-2-(3,4-dihydroxyphenyl)-4H-chromen-4-on 4H-1-Benzopyran-4-one, 2-(3,4-dihydroxyphenyl)-3,5,7-trihydroxy- 5-18-05-00494 (Beilstein Handbook Reference) 73123-10-1 74893-81-5 AI3-26018 BRN 0317313 C.I. 75670 C.I. Natural Yellow 10 CCRIS 1639 CI 75670 CI Natural Yellow 10 Cyanidelonon 1522 EINECS 204-187-1 Flavin meletin Flavone, 3,3',4',5,7-pentahydroxy- HSDB 3529 Kvercetin [Czech] Meletin NCI-C60106 NSC 9219 NSC 9221 Natural Yellow 10 QUERCETIN Quercetin content Quercetine Quercetol Quercitin Quertine Sophoretin T-Gelb bzw. grun 1 Xanthaurine
pdb file: 151474.pdb sdf file: 151474.sdf directory: 151474

1,3-Benzodioxole-5-carboxaldehyde 120-57-0 3,4-Bis(methylenedioxy)benzaldehyde 3,4-Dihydroxybenzaldehyde methylene ketal 3,4-Dimethylenedioxybenzaldehyde 3,4-Methylene-dihydroxybenzaldehyde 3,4-Methylenedioxybenzaldehyde 30024-74-9 5-Formyl-1,3-benzodioxole AI3-01198 Benzaldehyde, 3,4-(methylenedioxy)- CCRIS 5928 Dioxymethylene protocatechuic aldehyde Dioxymethylene-protocatechuic aldehyde EINECS 204-409-7 FEMA No. 2911 Geliotropin HSDB 581 Heliotropin Heliotropin (natural) Heliotropine NSC 26826 PIPERONAL Piperonaldehyde Piperonyl aldehyde Piperonylaldehyde Protocatechuic aldehyde methylene ether
pdb file: 151589.pdb sdf file: 151589.sdf directory: 151589

131-69-1 4'-(Acetylsulfamoyl)phthalanilic acid 8048-28-0 AI3-24457 Benzoic acid, 2-(((4-((acetylamino)sulfonyl)phenyl)amino)carbonyl)- EINECS 205-035-7 Enteramide Enterocid Enterosulfamid Enterosulfon Enterosulphamid Ftalicetimida Kalacet N(sup1)-Acetyl-N(sup4)-phthalylsulfanilamide N-(4-(Acetylsulphamoyl)phenyl)phthalamic acid N-(o-Carboxybenzoyl)sulfacetamide NSC 163977 PHTHALYLSULFACETAMIDE Phthalanilic acid, 4'-(acetylsulfamoyl)- Phthaloylsulfacetamide Phthalylsulfacetamid Phthalylsulfanilazetamid Phthalylsulphacetamide Rabalan Sterathal Sulphalyl TSC-80 Talasulfa Talecid Talicetimida Talsigel Talsutin Tamid Thalajen Thalamyd Thalisul Thalocid
pdb file: 151729.pdb sdf file: 151729.sdf directory: 151729

1,3-Benzenediol, 4-hexyl- 1,3-Dihydroxy-4-hexylbenzene 1,3-Dihydroxy-4-n-hexylbenzene 136-77-6 4-(1-Hexyl)resorcinol 4-06-00-06048 (Beilstein Handbook Reference) 4-Hexyl-1,3-benzenediol 4-Hexyl-1,3-dihydroxybenzene 4-Hexylresorcine 4-Hexylresorcinol 4-n-Hexylresorcinol AI3-08055 Adrover Antascarin Ascaricid Ascarinol Ascaryl BRN 2048312 CCRIS 888 Caprokol Crystoids Cystoids anthelmintic EINECS 205-257-4 Gelovermin HEXYLRESORCINOL HSDB 566 Hexylresorcin [German] Hexylresorcinolum Hexylresorzin Hidesol NCI-C55787 NSC 1570 Oxana Prensol Resorcinol, 4-hexyl- S.T. 37 ST 37 ST-37 Sucrets Worm-agen p-Hexylresorcinol
pdb file: 151855.pdb sdf file: 151855.sdf directory: 151855

137-20-2 2-(Methyl(1-oxo-9-octadecenyl)amino)ethanesulfonic acid, sodium salt 28776-17-2 32075-38-0 39388-01-7 Adinol T Alkyl sodium N-methyltaurate Concogel 2 conc. EINECS 205-285-7 Ethanesulfonic acid, 2-(methyl((9Z)-1-oxo-9-octadecenyl)amino)-, sodium salt Ethanesulfonic acid, 2-(methyl(1-oxo-9-octadecenyl)amino)-, sodium salt Ethanesulfonic acid, 2-(methyl(1-oxo-9-octadecenyl)amino)-, sodium salt, (Z)- Ethanesulfonic acid, 2-(methyl(1-oxo-9-octadecenyl)amino)-, sodium salt, Z- (9CI) HSDB 5624 Hostapon T Igepon T Igepon T 33 Igepon T 51 Igepon T 77 Igepon T-43 Igepon T-71 Igepon T-73 Igepon TE Metaupon paste N-Methyl-N-oleoyltaurine sodium salt N-Methyl-N-oleoyltaurine, sodium salt Nissan diapion S Nissan diapon T OMT Oleoylmethyltaurine sodium salt SODIUM N-METHYL-N-OLEOYLTAURATE Sodium 2-(N-methyloleamido)ethane-1-sulfonate Sodium 2-(methyloleoylamino)ethane-1-sulphonate Sodium N-methyl-N-oleoyl taurate Sodium N-oleoyl-N-methyl taurate Sodium N-oleoyl-N-methylataurine Sodium N-oleoyl-N-methyltaurate Sodium
pdb file: 151875.pdb sdf file: 151875.sdf directory: 151875

(-)-Lasiocarpine (7alpha-Angelyloxy-5,6,7,8alpha-tetrahydro-3H-pyrrolizin-1-yl)methyl-2,3-dihydroxy-2-(1'-methoxyethyl)-3-methylbutyrate (Z)-2-Methylcrotonic acid, 2,3-dihydroxy-2-(1-methoxyethyl)-3-methylbutyrate (ester) 2,3,5,7alphabeta-Tetrahydro-1-hydroxy-1H-pyrrolizine-7-methanol-1-angelate-7-(2,3-dihydroxy-2(1-methoxyethyl))-3-methyl-butyrate 2-Butenoic acid, 2-methyl-, 7-((2,3-dihydroxy-2-(1-methoxyethyl)-3-methyl-1-oxobutoxy)methyl)-2,3,5,7a-tetrahydro-1H-pyrrolizin-1-yl ester, (1S-(1alpha(Z),7(2S*,3R*),7a alpha))- 2-Butenoic acid, 2-methyl-, 7-((2,3-dihydroxy-2-(1-methoxyethyl)-3-methyl-1-oxobutoxy)methyl)-2,3,5,7a-tetrahydro-1H-pyrrolizin-1-yl ester, (1S-(1alpha(Z),7(2S*,3R*),7aalpha))- 303-34-4 7-Angelyleuropine AI3-51770 CCRIS 355 Europine 7-angelate HSDB 6062 Heliotridine ester with lasiocarpum and angelic acid LASIOCARPINE NCI-C01478 NSC 30625 RCRA waste no. U143 RCRA waste number U143
pdb file: 152544.pdb sdf file: 152544.sdf directory: 152544

1-(2-Hydroxy-1-ethyl)-2-methyl-5-nitroimidazole 1-(2-Hydroxyethyl)-2-methyl-5-nitroimidazole 1-(beta-Ethylol)-2-methyl-5-nitro-3-azapyrrole 1-(beta-Hydroxyethyl)-2-methyl-5-nitroimidazole 1-(beta-Oxyethyl)-2-methyl-5-nitroimidazole 1H-Imidazole-1-ethanol, 2-methyl-5-nitro- 2-Methyl-1-(2-hydroxyethyl)-5-nitroimidazole 2-Methyl-3-(2-hydroxyethyl)-4-nitroimidazole 2-Methyl-5-nitroimidazole-1-ethanol 443-48-1 5-23-05-00063 (Beilstein Handbook Reference) 69198-10-3 Acromona Anagiardil Arilin Atrivyl BRN 0611683 Bayer 5360 Bexon CCRIS 410 CONT Caswell No. 579AA Clont Danizol Deflamon Deflamon-wirkstoff EINECS 207-136-1 EPA Pesticide Chemical Code 120401 Efloran Elyzol Entizol Eumin Flagemona Flagesol Flagil Flagyl Flagyl I.V. RTU Fossyol Giatricol Gineflavir HSDB 3129 Imidazole-1-ethanol, 2-methyl-5-nitro- Klion Klont METRONIDAZOLE Meronidal Metro Gel Metro I.V. Metrogel Metronidaz Metronidazol Metronidazol [INN-Spanish] Metronidazole [USAN:BAN:INN:JAN] Metronidazolo Metronidazolo [DCIT] Metronidazolum [INN-Latin] Mexibol Mexibol 'silanes' Monagyl Monasin NIDA NSC 50364 NSC 69587 NSC-50364 Nalox Neo-tric Noritate Novonidazol Orvagil Protostat RP 8823
pdb file: 153152.pdb sdf file: 153152.sdf directory: 153152

1,6-Heptadiene-3,5-dione, 1,7-bis(4-hydroxy-3-methoxyphenyl)- 1,6-Heptadiene-3,5-dione, 1,7-bis(4-hydroxy-3-methoxyphenyl)-, (1E,6E)- 1,6-Heptadiene-3,5-dione, 1,7-bis(4-hydroxy-3-methoxyphenyl)-, (E,E)- 1,7-Bis(4-hydroxy-3-methoxyphenyl)-1,6-heptadiene-3,5-dione 1,7-Bis(4-hydroxy-3-methoxyphenyl)hepta-1,6-diene-3,5-dione 1,9-Bis(4-hydroxy-3-methoxyphenyl)-2,7-nonadiene-4,6-dione 15845-47-3 2,7-Nonadiene-4,6-dione, 1,9-bis(4-hydroxy-3-methoxyphenyl)- 33171-04-9 4-08-00-03697 (Beilstein Handbook Reference) 458-37-7 73729-23-4 79257-48-0 91884-86-5 BRN 2306965 C.I. 75300 C.I. Natural Yellow 3 CCRIS 3257 CI 75300 CI Natural Yellow 3 CURCUMIN Curcuma Curcumin I Diferaloylmethane Diferuloylmethane E 100 EINECS 207-280-5 Gelbwurz Golden seal HSDB 4334 Haidr Halad Haldar Halud Hydrastis Indian saffron Indian turmeric Kacha haldi Kurkumin [Czech] Merita earth NCI-C61325 NSC 32982 NSC 687842 Natural yellow 3 Orange Root Safran d'Inde Souchet Terra Merita Turmeric Turmeric yellow Yellow ginger Yellow puccoon Yellow root Yo-kin Zlut prirodni 3 [Czech]
pdb file: 153214.pdb sdf file: 153214.sdf directory: 153214

19-Oxo-3-beta,5,14-trihydroxy-5-beta-bufa-20,22-dienolide 465-90-7 5-18-05-00180 (Beilstein Handbook Reference) 5-beta-BUFA-20,22-DIENOLIDE, 3-beta,5,14-TRIHYDROXY-19-OXO- BRN 0056259 Bufa-20,22-dienolide, 3,5,14-trihydroxy-19-oxo-, (3beta,5beta)- Bufotalidin EINECS 207-368-3 Gellebrigenin Hellebrigenin NSC 89594
pdb file: 153302.pdb sdf file: 153302.sdf directory: 153302

(R)-9-(2,3-Dihydroxy-3-methylbutoxy)-4-methoxy-7H-furo(3,2-g)(1)benzopyran-7-one 482-25-7 7H-FURO(3,2-g)(1)BENZOPYRAN-7-ONE, 9-(2,3-DIHYDROXY-3-METHYLBUTOXY)-4-METHOXY-, 7H-Furo(3,2-g)(1)benzopyran-7-one, 9-(2,3-dihydroxy-3-methylbutoxy)-4-methoxy-, (R)- 9-(2,3-Dihydroxy-3-methylbutoxy)-4-methoxy-7H-furo(3,2-g)(1)benzopyran-7-one Biacangelicin Bjacangelicin Bjakangelicin Byak-angelicin Byakangelicin Byankagelicine
pdb file: 153457.pdb sdf file: 153457.sdf directory: 153457

1,1'-Thiobis(2-chloroethane) 1-Chloro-2-(beta-chloroethylthio)ethane 2,2'-Dichlorodiethyl sulfide 2,2'-Dichlorodiethyl sulphide 2,2'-Dichloroethyl sulfide 2,2'-Dichloroethyl sulphide 39472-40-7 4-01-00-01407 (Beilstein Handbook Reference) 505-60-2 68157-62-0 69020-37-7 BIS(2-CHLOROETHYL)SULFIDE BRN 1733595 Bis(2-chloroethyl) sulfide Bis(2-chloroethyl)sulphide Bis(beta-chloroethyl)sulfide Bis(beta-chloroethyl)sulphide CCRIS 570 Di-2-chloroethyl sulfide Di-2-chloroethyl sulphide Dichlorodiethyl sulfide Dichloroethyl sulfide [Forbidden] Diethyl sulfide, 2,2'-dichloro Distilled mustard Ethane, 1,1'-thiobis(2-chloro- Gelbkreuz Gelbkreuz [Czech] HD HSDB 336 Kampstoff lost Lost Mustard HD Mustard gas Mustard vapor Mustard, sulfur S mustard S-Lost S-Yperite Schwefel-lost Senfgas Sulfide, bis(2-chloroethyl) Sulfur mustard Sulfur mustard gas Sulphur mustard Sulphur mustard gas UN 2927 Yellow Cross Gas Yellow cross liquid Yperite beta,beta'-Dichloroethyl sulfide beta,beta'-Dichloroethyl sulphide beta,beta-Dichlor-ethyl-sulphide
pdb file: 153746.pdb sdf file: 153746.sdf directory: 153746

(3R-(3alpha,4abeta,5alpha,8alpha,8abeta,9S*,10S*))-5-ethenyl-3,4,4a,5,6,7,8,8a-octahydro-7-methylspiro(3,5,8-ethanylylidene-1H-pyrano(3,4-c)pyridine-10,3'-(3H)indol)-2'(1',H)-one 4-27-00-07526 (Beilstein Handbook Reference) 509-15-9 BRN 5406576 EINECS 208-095-2 GELSEMINE Gelsemin HSDB 3488 NSC 21729 Spiro(3,5,8-ethanylylidene-1H-pyrano(3,4-c)pyridine-10,3'-(3H)indol)-2'(1'H)-one, 5-ethenyl-3,4,4a,5,6,7,8,8a-octahydro-7-methyl-, (3R-(3alpha,4abeta,5alpha,8alpha,8abeta,9S*,10S*))-
pdb file: 153799.pdb sdf file: 153799.sdf directory: 153799

1,3,8-Trihydroxy-6-methyl-9,10-anthracenedione 1,3,8-Trihydroxy-6-methyl-9,10-anthraquinone 1,3,8-Trihydroxy-6-methylanthraquinone 3-Methyl-1,6,8-trihydroxyanthraquinone 4,5,7-Trihydroxy-2-methylanthraquinone 4-08-00-03575 (Beilstein Handbook Reference) 518-82-1 6-Methyl-1,3,8-trihydroxyanthraquinone 9,10-Anthracenedione, 1,3,8-trihydroxy-6-methyl- (9CI) AI3-38286 Anthraquinone, 1,3,8-trihydroxy-6-methyl- Anthraquinone, 1,3,8-trihydroxy-6-methyl- (8CI) Anthraquinone, 6-methyl-1,3,8-trihydroxy- BRN 1888141 C.I. 75440 C.I. Natural Yellow 14 CCRIS 3528 EINECS 208-258-8 EMODIN Emodol Frangula emodin HSDB 7093 NSC 408120 NSC 622947 Persian Berry Lake Rheum emodin Schuttgelb
pdb file: 153905.pdb sdf file: 153905.sdf directory: 153905

2-Propenoic acid, 3-(4-hydroxy-5-benzofuranyl)-, delta-lactone 2H-Furo(2,3-H)-1-benzopyran-2-one 2H-Furo(2,3-h)(1)benzopyran-2-one 3-(4-Hydroxy-5-benzofuranyl)-2-propenoic acid gamma-lactone 39310-13-9 4-Hydroxy-5-benzofuranacrylic acid gamma-lactone 5-19-04-00447 (Beilstein Handbook Reference) 523-50-2 Angecin Angelicin Angelicin (VAN) Angelicin (coumarin deriv) Angelicin (coumarin derivative) Angelicin plus ultraviolet A radiation [Angelicins] BRN 0153970 CCRIS 4276 Furo(2,3-h)coumarin Furo(5',4':7,8)coumarin HSDB 3554 ISOPSORALEN NSC 404563
pdb file: 153958.pdb sdf file: 153958.sdf directory: 153958

2-(3,4-Dihydroxyphenyl)-3,7-dihydroxy-4H-1-benzopyran-4-one 3,3',4',7-Tetrahydroxyflavone 4H-1-Benzopyran-4-one, 2-(3,4-dihydroxyphenyl)-3,7-dihydroxy- 5-18-05-00291 (Beilstein Handbook Reference) 5-Desoxyquercetin 528-48-3 BOIS bleude honqrie BRN 0292829 Bois bleu de Honqrie C.I. 75620 C.I. Natural Brown 1 Cotinin EINECS 208-434-4 FLAVONE, 3,3',4',7-TETRAHYDROXY- Fietin Fisetholz Fisetin Fustel Fustet Junger fustik NSC 407010 NSC 656275 Superfustel Superfustel K Ungarisches gelbholz Ventin sumach Viset Young fustic Young fustic crystals Zante fustic
pdb file: 154013.pdb sdf file: 154013.sdf directory: 154013

2(5H)-FURANONE, 5-METHYL- 2-Pentanoic acid, 4-hydroxy-, gamma-lactone (6CI,7CI) 2-Penten-4-olide 2-Pentenoic acid, 4-hydroxy-, gamma-lactone 4-Hydroxy-2-pentenoic acid gamma-lactone 5-17-09-00121 (Beilstein Handbook Reference) 5-Methyl-2(5H)-furanone 5-Methylfuran-2(5H)-one 591-11-7 AI3-61052 BRN 0108058 EINECS 209-700-2 NSC 655 alpha,beta-Angelica lactone delta(sup 1)-Angelica lactone delta(sup1)-Angelica lactone delta1-Angelica lactone gamma-Methyl-alpha,beta-crotonolactone
pdb file: 154865.pdb sdf file: 154865.sdf directory: 154865

2(3H)-FURANONE, 5-METHYL- 3-Pentenoic acid, 4-hydroxy-, gamma-lactone 4-Hydroxy-3-pentenoic acid gamma-lactone 4-Hydroxypent-3-enoic acid lactone 5-17-09-00120 (Beilstein Handbook Reference) 5-Methyl-2(3H)-furanone 5-Methylfuran-2(3H)-one 591-12-8 AI3-04326 BRN 0108394 CCRIS 3594 EINECS 209-701-8 FEMA No. 3293 NSC 654 alpha(beta,gamma or delta2)-Angelica lactone alpha-Angelica lactone alpha-Angelicalactone delta(2)-Angelica lactone delta(sup 2)-Angelica lactone gamma-Methyl-beta,gamma-crotonolactone
pdb file: 154866.pdb sdf file: 154866.sdf directory: 154866

1-NAPHTHOL, 2,4-DINITRO- 1-Naphthalenol, 2,4-dinitro- 2,4-Dinitro-1-naftol [Czech] 2,4-Dinitro-1-naphthol 2,4-Dinitronaphthol 2-4 Dinitro-alpha-naphtol [French] 4-06-00-04240 (Beilstein Handbook Reference) 605-69-6 AI3-62661 BRN 2057462 C.I. 10315 EINECS 210-093-1 Golden yellow Manchester Yellow Maritus Yellow Martinsgelb Martius yellow NSC 6148 Naphthylene Yellow Saffron Yellow Zlut marciova [Czech] Zlut naftolova [Czech]
pdb file: 155113.pdb sdf file: 155113.sdf directory: 155113

637-12-7 65324-35-8 AI3-01515 ALUMINUM TRISTEARATE Alugel 34TN Aluminium stearate Aluminium tristearate, pure Aluminum (III) stearate Aluminum octadecanoate Aluminum stearate Aluminum stearate (1:3) Aluminum stearate, tribasic Aluminum(III) stearate Aluminum, dihydroxy(octadecanoato-O)- Dihydroxy(octanoato-O)aluminum EINECS 211-279-5 HSDB 5733 Metasap XX Monoaluminum stearate Octadecanoic acid, aluminum salt Octadecanoic acid, aluminum salt (3:1) Rofob 3 SA 1500 Stearic acid, aluminum salt Tribasic aluminum stearate
pdb file: 155816.pdb sdf file: 155816.sdf directory: 155816

1252-37-5 3-o-Chlorophenyl-5-methyl-4-isoxazolylpenicillin sodium 4-Thia-1-azabicyclo(3.2.0)heptane-2-carboxylic acid, 6-(3-(2-chlorophenyl)-5-methyl-4-isoxazolecarboxamido)-3,3-dimethyl-7-oxo-, monosodium salt, (2S,5R,6R)- 4-Thia-1-azabicyclo(3.2.0)heptane-2-carboxylic acid, 6-(3-(2-chlorophenyl)-5-methyl-4-isoxazolecarboxamido)-3,3-dimethyl-7-oxo-, monosodium salt, (2S-(2alpha,5alpha,6beta))- 4-Thia-1-azabicyclo(3.2.0)heptane-2-carboxylic acid, 6-(3-(o-chlorophenyl)-5-methyl-4-isoxazolecarboxamido)-3,3-dimethyl-7-oxo-, monosodium salt 50794-85-9 642-78-4 Ankerbin Austrastaph BRL 1621 sodium salt BRL-1621 sodium salt CLOXACILLIN SODIUM, ANHYDROUS Cloxacillin sodium Cloxacillin sodium anhydrous Cloxapen EINECS 211-390-9 Ekvacillin Gelstaph Monosodium cloxacillin Orbenin sodium Prevencilina P Prostaphilin A Prostaphlin A Sodium 3-(o-chlorophenyl)-5-methyl-4-isoxazolylpenicillin Sodium cloxacillin Sodium orbenin Sodium syntarpen Staphybiotic Syntarpen sodium salt Tegopen
pdb file: 155881.pdb sdf file: 155881.sdf directory: 155881

17690-54-9 2-BUTENOIC ACID, 2-METHYL-, 2,3,5,7a-TETRAHYDRO-7-(HYDROXYMETHYL)-1H-PYRROLIZIN- 2-Butenoic acid, 2-methyl-, 2,3,5,7a-tetrahydro-7-(hydroxymethyl)-1H-pyrrolizin-1-yl ester, (1S-(1-alpha(Z),7a-alpha))- 6029-83-0 7-Angeloylheliotridine 7-Angelylheliotridine 723-78-4 O-7-Angelylheliotridine Rivularine
pdb file: 156230.pdb sdf file: 156230.sdf directory: 156230

1-(Phenylazo)-2-naphthalenol 1-Benzoazo-2-naphthol 1-Phenylazo-2-naphthol 1-Phenylazo-beta-naphthol 104407-03-6 2-Hydroxy-1-phenylazonaphthalene 2-Hydroxynaphthyl-1-azobenzene 2-Naphthalenol, 1-(phenylazo)- 2-Naphthol, 1-(phenylazo)- 2-Naphtholazobenzene 4-16-00-00228 (Beilstein Handbook Reference) 842-07-9 Atul Orange R BRN 0651992 Benzene-1-azo-2-naphthol Benzeneazo-beta-naphthol Brasilazina Oil Orange Brilliant Oil Orange R C. I. Solvent Yellow 14 C.I. 12055 C.I. Disperse Yellow 97 C.I. Solvent Yellow 14 CCRIS 174 CI 12055 Calco Oil Orange 7078 Calco Oil Orange 7078-Y Calco Oil Orange Z-7078 Calcogas M Calcogas Orange NC Campbelline Oil Orange Carminaph Ceres Orange R Cerotinorange G Disperse Yellow 97 Dispersol Yellow PP Dunkelgelb EINECS 212-668-2 Enial Orange I Fast Oil Orange Fast Oil Orange I Fast Orange Fat Orange
pdb file: 156652.pdb sdf file: 156652.sdf directory: 156652

2-BUTENOIC ACID, 2-METHYL, 2,3,5,7a-TETRAHYDRO-7-(HYDROXYMETHYL)-1H-PYRROLIZIN-1 2-Butenoic acid, 2-methyl, 2,3,5,7a-tetrahydro-7-(hydroxymethyl)-1H-pyrrolizin-1-yl ester, hydrochloride, (Z)- 7-Angeloylheliotridine hydrochloride 7-Angelylheliotridine hydrochloride 887-66-1 O-7-Angelylheliotridine hydrochloride Rivularine hydrochloride
pdb file: 156805.pdb sdf file: 156805.sdf directory: 156805

1308-14-1 CHROMIUM TRIHYDROXIDE Chromic (III) hydroxide Chromic acid (H3CrO3) Chromic hydroxide Chromic hydroxide [Chromium and chromium compounds] Chromic oxide gel Chromic oxide, hydrous Chromium hydroxide Chromium hydroxide (Cr(OH)3) Chromium(3+) hydroxide Chromium(III) hydroxide Dichromium trioxide hydrate EINECS 215-158-8 HSDB 5796
pdb file: 158033.pdb sdf file: 158033.sdf directory: 158033

12195-86-7 1309-42-8 13760-51-5 200-06H Alcanex NHC 25 Arthritis Pain Formula Maximum Strength Asahi Glass 200-06 Ascriptin Baschem 12 CCRIS 3342 Calcitrel Camalox Combustrol 500 DP 393 DSB 100 Di-Gel Duhor Duhor N EINECS 215-170-3 Ebson RF FloMag H FloMag HUS Gelusil HSDB 659 Haley's MO Hydro-mag MA Hydrofy G 1.5 Hydrofy G 2.5 Hydrofy N KX 8S(A) KX 8S(B) Ki 22-5B Kisuma 4AF Kisuma 5 Kisuma 5A Kisuma 5B Kisuma 5B-N Kisuma 5BG Kisuma 5E Kisuma 78 Kisuma S 4 Kudrox Kyowamag F Lycal 96 HSE MAGNESIUM HYDROXIDE Maalox Maalox Plus Mag Chem MH 10 Magmesia hydrate MagneClear 58
pdb file: 158040.pdb sdf file: 158040.sdf directory: 158040

10193-36-9 12673-75-5 1343-98-2 158296-67-4 68373-08-0 7699-41-4 84141-05-9 9063-16-5 98530-20-2 Caswell No. 734 Cubosic EINECS 215-683-2 EPA Pesticide Chemical Code 072602 G 952 H-Ilerit Hydrosilisic acid K 320DS K 60 K 60 (silicate) Mikronisil Neoxyl ET Polyorthosilicic acid Polysilicic acid SILICIC ACID Silica acid Silica gel Silicic acid (polyortho) Silicic acid hydrate Silicon hydroxide Silton TF 06 Sipernat 17 Sipernat 50 Sipernat 50S Sipernat D 10 Sipernat S Sizol 030 Vulcasil S/GR Zeosil 45
pdb file: 158239.pdb sdf file: 158239.sdf directory: 158239

(-)-delta(sup 1)-3,4-trans-Tetrahydrocannabinol (-)-delta9-(trans)-Tetrahydrocannabinol (-)-delta9-trans-Tetrahydrocannabinol (6aR,10aR)-6a,7,8,10a-Tetrahydro-6,6,9-trimethyl-3-pentyl-6H-dibenzo(b,d)pyran-1-ol (6aR-trans)-6a,7,8,10a-Tetrahydro-6,6,9-trimethyl-3-pentyl-6H-dibenzo(b,d)pyran-1-ol (l)-delta(sup 1)-Tetrahydrocannabinol 1-trans-delta(sup 9)-Tetrahydrocannabinol 1-trans-delta-9-Tetrahydrocannabinol 1-trans-delta9-Tetrahydrocannabinol 1363-19-5 14146-29-3 14146-43-1 1972-08-3 26108-45-2 3-Pentyl-6,6,9-trimethyl-6a,7,8,10a-tetrahydro-6H-dibenzo(b,d)pyran-1-ol 5957-27-7 6,6,9-Trimethyl-3-pentyl-7,8,9,10-tetrahydro-6H-dibenzo(b,d)pyran-1-ol 6H-Dibenzo(b,d)pyran-1-ol, 6a,7,8,10a-tetrahydro-6,6,9-trimethyl-3-pentyl-, (6aR,10aR)- 6H-Dibenzo(b,d)pyran-1-ol, 6a,7,8,10a-tetrahydro-6,6,9-trimethyl-3-pentyl-, (6aR-trans)- Abbott 40566 CCRIS 4726 Cannabinol, 1-trans-delta(sup 9)-tetrahydro- Cannabinol, delta1-tetrahydro- DEA No. 7369 DEA No. 7370 DRG-0138 Deltanyne Dronabinol Dronabinol [USAN:INN] Dronabinol in sesame oil and encapsulated in a soft gelatin capsule in a U.S. FDA approved drug product Dronabinolum [Latin] HSDB 6471 Marinol NSC 134454 QCD 84924 QCD-84924 SP 104 TETRAHYDROCANNABINOL THC Tetrahydro-6,6,9-trimethyl-3-pentyl-6H-dibenzo(b,d)pyran-1-ol Tetrahydrocannabinols Tetrahydrocannabinols (-)-delta1-3,4-trans-form delta(9)-Tetrahydrocannibinol delta(sup 1)-Tetrahydrocannabinol delta(sup 1)-Thc delta(sup 9)-Tetrahydrocannabinol delta(sup 9)-Thc delta1-THC delta1-Tetrahydrocannabinol delta1-Tetrahydrocannabinol (VAN) delta9-THC delta9-Tetrahydrocannabinol (VAN) l-delta1-trans-Tetrahydrocannabinol
pdb file: 159358.pdb sdf file: 159358.sdf directory: 159358

2-(p-Butoxyphenyl)-acetohydroxamic acid 2438-72-4 4-Butoxy-N-hydroxybenzeneacetamide 4-Butoxyphenylacetohydroxamic acid ACETOHYDROXAMIC ACID, 2-(p-BUTOXYPHENYL)- Acide p-butoxyphenylacethydroxamique [French] Anderm BRN 2646848 Benzeneacetamide, 4-butoxy-N-hydroxy- (9CI) Bufessamac [DCIT] Bufexamac Bufexamac [BAN:DCF:INN:JAN] Bufexamaco [INN-Spanish] Bufexamacum [INN-Latin] Bufexamic acid CP 1044 CP 1044 J3 Droxaryl EINECS 219-451-1 Feximac Flogicid Flogocid N plastigel J3 Malipuran Mofenar Norfemac Parfenac Parfenal p-Butoxyphenylacetohydroxamic acid
pdb file: 160300.pdb sdf file: 160300.sdf directory: 160300

16059-99-7 3615-82-5 Calcium-magnesium phytate EINECS 222-798-1 Eviunis Forglesan Fosforo de Angeli INOSITOL, HEXAKIS(DIHYDROGEN PHOSPHATE), CALCIUM MAGNESIUM SALT, myo- Inophosphan Inositocalcium Phosbiose Phytic acid calcium magnesium salt Phytin Phytocalcium Phytophosphine myo-Inositol, hexakis(dihydrogen phosphate), calcium magnesium salt
pdb file: 162175.pdb sdf file: 162175.sdf directory: 162175

4594-02-9 5-21-05-00151 (Beilstein Handbook Reference) 6,7-Dimethoxy-1-methylisoquinoline BRN 0148112 ISOQUINOLINE, 6,7-DIMETHOXY-1-METHYL- Isosalsolidine Nigellimine
pdb file: 163526.pdb sdf file: 163526.sdf directory: 163526

(1,1'-Biphenyl)-4-acetic acid 4-09-00-02520 (Beilstein Handbook Reference) 4-BIPHENYLACETIC ACID 4-Biphenylylacetic acid 4-Carboxymethylbiphenyl 5728-52-9 Acetic acid, (4-biphenylyl)- BRN 1211592 CL 83544 Dolinac EINECS 227-233-2 Felbinac Felbinac [USAN:BAN:INN:JAN] Felbinaco [Spanish] Felbinacum [Latin] L 141 LJC 10,141 LY 61017 NSC 16284 Napageln Target Traxam p-Biphenylylacetic acid
pdb file: 164659.pdb sdf file: 164659.sdf directory: 164659

127-09-3 6131-90-4 Acetic acid, sodium salt, trihydrate Natrium acetate-3-wasser Plasmafusin SODIUM ACETATE TRIHYDRATE Sodium acetate Sodium acetate [USAN:JAN] Thomaegelin Tutofusin
pdb file: 165160.pdb sdf file: 165160.sdf directory: 165160

1394-90-7 25255-37-2 37-02-5 47918-34-3 55125-87-6 6805-41-0 A-4700 Aescin [German] Aescusan Amorphous aescin EINECS 229-880-6 ESCIN (R = Tiglic acid or Angelic acid) Escin Escina [Italian] Reparilu [Czech]
pdb file: 165823.pdb sdf file: 165823.sdf directory: 165823

18-beta-Glycyrrhetinic acid hydrogen succinate, disodium salt 3-O-(beta-Carboxypropionyl)-11-oxo-18-beta-olean-12-en-30-oic acid, disodium salt 3-beta-Hydroxy-11-oxoolean-12-en-30-oic acid hydrogen succinate, disodium salt 3beta-Hydroxy-11-oxoolean-12-en-30-oic acid hydrogen succinate disodium salt 5697-56-3 7421-40-1 Biogastrone CARBENOXOLONE SODIUM Carbenoxolon-dinatrium Carbenoxolone disodium Carbenoxolone sodium [USAN:JAN] Carbenoxolone, disodium salt Disodium glycyrrhetinyl succina Duogastrone EINECS 231-044-0 Glycyrrhetinic acid hydrogen succinate, disodium salt Neogel Olean-12-en-29-oic acid, 3-(3-carboxy-1-oxopropoxy)-11-oxo, disodium salt, (3beta,20beta)- Olean-12-en-29-oic acid, 3-(3-carboxy-1-oxopropoxy)-11-oxo-, disodium salt, (3-beta,20-beta)- Olean-12-en-30-oic acid, 3-beta-hydroxy-11-oxo-, hydrogen succinate, disodium salt Pyrogastrone Sanodin Sodium 3-beta-hydroxy-11-oxo-12-oleanen-30-oate sodium succinate Sodium carbenoxolone Terulcon tabletten Ulcus-tablinen
pdb file: 166425.pdb sdf file: 166425.sdf directory: 166425

7631-86-9 AI3-25549 Acticel Aerogel 200 Aerosil Aerosil 300 Aerosil 380 Aerosil A 300 Aerosil E 300 Aerosil K 7 Aerosil M-300 Aerosil bs-50 Aerosil-degussa Amorphous silica Amorphous silica dust Amorphous silica gel CAB-O-SIL N-70TS CCRIS 3699 CI 7811 Cab-o-sil M-5 Cabosil N 5 Cabosil st-1 Carplex Carplex 30 Carplex 80 Caswell No. 734A Celite superfloss Chalcedony Colloidal silicon dioxide Corasil II Cristobalite Diatomaceous earth Diatomaceous earth, calcined Diatomaceous silica Diatomite Dimethyl siloxanes and silicones Dri-Die EINECS 231-545-4 ENT 25,550 EPA Pesticide Chemical Code 072605 Extrusil Fossil flour Fused silica Glass HK 400 Hi-Sil Hydrophobic silica 2482 Infusorial earth Ludox
pdb file: 166773.pdb sdf file: 166773.sdf directory: 166773

227453-69-2 56172-57-7 7681-52-9 8007-59-8 AD Gel Antiformin B-K liquid CCRIS 708 Carrel-dakin solution Caswell No. 776 Chlorinated water (sodium hypochlorite) Chloros Chlorox Cloralex Cloropool Clorox Clorox liquid bleach Dakin's solution Dakins solution Deosan Deosan Green Label Steriliser Dispatch EINECS 231-668-3 EPA Pesticide Chemical Code 014703 HSDB 748 Hospital Milton Household bleach Hyclorite Hypochlorite sodium Hypochlorous acid, sodium salt Hyposan and Voxsan Hypure Hypure N Javel water Javelle water Javex Klorocin Milton Milton Crystals Modified dakin's solution Neo-cleaner Neoseptal CL Parozone Purin B SODIUM HYPOCHLORITE Sodium hypochlorite (NaClO) Sodium hypochlorite (NaOCl) Sodium hypochlorite [Hypochloride salts] Sodium hypochlorite [USAN:JAN] Sodium hypochlorite
pdb file: 166856.pdb sdf file: 166856.sdf directory: 166856

12324-56-0 12324-60-6 7783-47-3 AIM Cap-Tin Mouthrinse Crest EINECS 231-999-3 Easygel Fluoristan Gel-Kam Gel-Tin HSDB 783 Iradicar SnF2 Iradicar Stannous Fluoride Iradicav SnF2 King's Gel-Tin Omnii-Gel Oral-B Rinsing solution, concentrate STANNOUS FLUORIDE Stancare Stanide Stannous fluoride (SnF2) Stop Stop Home Treatment Tin bifluoride Tin difluoride Tin fluoride (SnF2) Tin(II) fluoride
pdb file: 167065.pdb sdf file: 167065.sdf directory: 167065

12000-69-0 12124-89-9 2-(2-Quinolyl)-1,3-indandione disulfonic acid disodium salt 39354-67-1 65721-84-8 8004-92-0 83711-72-2 Acid yellow 3 Basacid Yellow 094 C.I. 47005 C.I. ACID YELLOW 3 C.I. Food Yellow 13 CI 47005 Chinogelb Extra [German] Chinogelb [German] Chinogelb wasserloeslich [German] D & C Yellow no. 10 D and C Yellow No. 10 Dye Quinoline Yellow E 104 E 104 (dye) FD and C Yellow No. 10 Food Yellow 13 Japan Yellow 203 Jaune de quinoleine [French] L-Gelb 3 [German] Lemon Yellow ZN 3 Quinidine Yellow KT Quinoline Yellow Quinoline Yellow Extra Quinoline Yellow S Quinoline yellow WS Schultz No. 918 Vitasyn Quinoline
pdb file: 167227.pdb sdf file: 167227.sdf directory: 167227

8050-81-5 Antifoam A Asidopan Plus DC antifoam A Di-Gel Gas-X Gelusil HSDB 3906 Kudrox Maalox HRF Maalox Plus Mylanta Mylanta Gas Relief Mylicon Infant's Drops OCTAMETHYLTRISILOXANE Phazyme Riopan Plus Rioplus Sentry Simethicone Sentry Simethicone Emulsion Silicone antifoam agent S 184 Silicone antifoam emulsions SE 6 and SE 9 Simeco Simethicone Simethicone [USAN] Wydrate Plus alpha-(Trimethylsilyl)-omega-methylpoly(oxy(dimethylsilylene)), mixture with silicon dioxide
pdb file: 167325.pdb sdf file: 167325.sdf directory: 167325

1,3,5-Triazine-2,4-diamine, N,N'-bis(1-methylethyl)-6-(methylthio)-, mixt. with 6-chloro-N-ethyl-N'-(1-methylethyl)-1,3,5-triazine-2,4-diamine 39324-67-9 39464-88-5 53240-91-8 56509-39-8 8073-77-6 A 1798 AGELON (ALSO SEE CAS NO. 39464-88-5) Agelon Agelon 1798 Apropin Atrazine-gesagard mixt. Atrazine-prometryn mixt. Atrazine-prometryne mixt. Gesaprim 1798 Gesaprim multy Inakor Inakor T Prozin Prozin 50 Zeaprim Zeazin Mix
pdb file: 167356.pdb sdf file: 167356.sdf directory: 167356

177317-30-5 191616-54-3 196886-89-2 204336-41-4 7H 7H (carbohydrate) 9000-11-7 Acetic acid, hydroxy-, cellulose ether Almelose Apergel Apeyel CARBOXYMETHYL CELLULOSE CM-Cellulose CMC CMC-4LF Carbose Carboximethylcellulosum Carboxymethyl cellulose ether Carboxymethylated cellulose pulp Carboxymethylcellulose Carboxymethylcellulose cellulose carboxymethyl ether Carboxymethylcellulosum Carmellosum [INN-Latin] Carmelosa [INN-Spanish] Cellulose GUM 7H Cellulose carboxymethylate Cellulose, (carboxymethyl) Cellulose, carboxymethyl ether Cellulose, ether with glycolic acid Celluloseglycolic acid Colloresine Croscarmellose Croscarmellosum [INN-Latin] Croscarmellosum [Latin] Croscarmelosa [INN-Spanish] Duodcel FEMA No. 2239 Glycocel TA Glycolic acid cellulose ether KMTs Thylose
pdb file: 167365.pdb sdf file: 167365.sdf directory: 167365

106442-33-5 147827-36-9 151439-02-0 155421-52-6 162261-31-6 25038-51-1 39320-29-1 53241-16-0 58740-50-4 61584-38-1 9002-89-5 9014-14-6 9050-53-7 9066-05-1 98002-48-3 Alcotex 17F-H Alcotex 88/05 Alcotex 88/10 Alcotex 99/10 Alkotex Alvyl Aracet APV Cipoviol W 72 Covol Covol 971 EP 160 Elvanol Elvanol 50-42 Elvanol 51-05G Elvanol 5105 Elvanol 52-22 Elvanol 52-22G Elvanol 522-22 Elvanol 70-05 Elvanol 71-30 Elvanol 73125G Elvanol 90-50 Elvanol T 25 Enbra OV Ethenol, homopolymer FH 1500 GH 20 GL 02 GL 03 GLO 5 GM 14 Galvatol 1-60 Gelvatol Gelvatol 1-30 Gelvatol 1-60 Gelvatol 1-90 Gelvatol 20-30 Gelvatol 2060 Gelvatol 2090 Gelvatol 3-91 Gohsenol Gohsenol AH 22 Gohsenol GH Gohsenol
pdb file: 167405.pdb sdf file: 167405.sdf directory: 167405

104981-89-7 114265-35-9 12624-24-7 143180-09-0 143180-13-6 143180-22-7 143749-07-9 2-Propenamide, homopolymer 25038-45-3 27754-57-0 33338-03-3 39355-07-2 39387-77-4 51312-40-4 57679-11-5 68247-81-4 72270-86-1 72283-66-0 79079-15-5 9003-05-8 9082-06-8 AP 273 Acrylamide homopolymer Acrylamide polymer Acrylamide, polymers Aerofloc 3453 American Cyanamid KPAM American Cyanamid P-250 Aminogen PA Bio-Gel P 2 BioGel P-100 Cyanamer P 250 Cyanamer P 35 Cytame 5 Diaclear MA 3000H Dow 164 Dow ET 597 Dow J 100 ET 597 Flokonit E Flygtol GB Gelamide 250 HSDB 1062 Himoloc OK 507 Himoloc SS 200 J 100 J 100 (VAN) J 100 (polymer) K 4 (acrylic polymer) K-PAM Magnafloc R 292 NSC 116573 NSC
pdb file: 167410.pdb sdf file: 167410.sdf directory: 167410

117385-93-0 12624-09-8 198084-97-8 37231-14-4 37231-15-5 50642-44-9 54018-17-6 55607-96-0 73699-63-5 7H3SF 80296-93-1 81209-86-1 82197-79-3 9004-32-4 9045-95-8 9085-26-1 AC-Di-sol. NF Aku-W 515 Aquaplast Avicel RC/CL B 10 B 10 (Polysaccharide) Blanose BS 190 Blanose BWM CCRIS 3653 CM-Cellulose sodium salt CMC CMC 2 CMC 3M5T CMC 41A CMC 4H1 CMC 4M6 CMC 7H CMC 7H3SF CMC 7L1 CMC 7M CMC 7MT CMC sodium salt Camellose gum Carbose 1M Carboxymethyl cellulose Carboxymethyl cellulose, sodium salt Carboxymethylcellulose Carboxymethylcellulose Sodium [USAN] Carboxymethylcellulose sodium Carboxymethylcellulose sodium salt Carmellose gum Carmethose Cellofas Cellofas B Cellofas B5 Cellofas B50 Cellofas B6 Cellofas C Cellogel C Cellogen 3H
pdb file: 167428.pdb sdf file: 167428.sdf directory: 167428

103288-81-9 120300-14-3 125807-44-5 155860-40-5 50806-92-3 58318-12-0 58517-46-7 66419-14-5 70992-66-4 71812-17-4 81210-20-0 81210-21-1 87582-55-6 9004-35-7 A 432-130B Acetate cotton Acetate ester of cellulose Acetic acid, cellulose ester Acetose Acetyl 35 Acetylcellulose Allogel Ampacet C/A Bioden CELLULOSE ACETATE Ca (cellulose acetate) Cellidor Cellidor A Cellit K 700 Cellit L 700 Cellulose 2,5-acetate Cellulose Acetate [USAN] Cellulose monoacetate Cellulose, 2,5-diacetate Cellulose, acetate Crellate DP 02 DP 06 E 376-40 E 383-40 E 394-30 E 394-40 E 394-45 E 394-60 E 398-10 E-400-25 Eastman 298-10 Etrol OEM HSDB 964 Monoacetylcellulose Nicollembal Nixon C/A PP 612 PP 613 PP 628 Plastacele Stripmix Strux Tenite
pdb file: 167430.pdb sdf file: 167430.sdf directory: 167430

10060-08-9 13765-19-0 CALCIUM CHROMATE CCRIS 156 Calcium Chrome Yellow Calcium chromate [Chromium and chromium compounds] Calcium chromate(VI) Calcium chromium oxide (CaCrO4) Calcium monochromate Chromatite syn Chromic acid (H2CrO4), calcium salt (1:1) Chromic acid H2CrO4, calcium salt Chromic acid, calcium salt Chromic acid, calcium salt (1:1) EINECS 237-366-8 Gelbin HSDB 248 NSC 176337 RCRA waste no. U032 RCRA waste number U032 Sintered calcium chromate Yellow ultramarine
pdb file: 169006.pdb sdf file: 169006.sdf directory: 169006

(Z)-2-Methyl-2-butenenitrile 2-Butenenitrile, 2-methyl-, (2Z)- 2-Butenenitrile, 2-methyl-, (Z)- 2-METHYL-2-BUTENENITRILE 2-Methyl-cis-2-butenenitrile 20068-02-4 Angelic acid nitrile Angeliconitrile Crotononitrile, 2-methyl-, (Z)- EINECS 243-496-6 HSDB 6156 cis-2-Methyl-2-butenenitrile cis-2-Methyl-2-butenonitrile
pdb file: 172166.pdb sdf file: 172166.sdf directory: 172166

106152-09-4 12252-70-9 128083-27-2 1302-29-0 13783-16-9 151393-94-1 159704-77-5 21645-51-2 51330-22-4 8012-63-3 8064-00-4 A 3011 AC 450 AC 714KC AE 107 AF 260 AKP-DA ALUMINUM HYDROXIDE ALternaGEL Alcoa 331 Alcoa 710 Alcoa A 325 Alcoa AS 301 Alcoa C 30BF Alcoa C 31 Alcoa C 33 Alcoa C 330 Alcoa C 331 Alcoa C 333 Alcoa C 385 Alcoa H 65 Alhydrogel Alolt 8 Alolt 80 Alolt 90 Alu-Cap Alugel Alugelibye Alumigel Alumina trihydrate Aluminic acid (H3AlO3) Aluminium hydroxide Aluminum hydroxide (Al(OH)3) Aluminum hydroxide gel Aluminum hydroxide, dried [JAN] Aluminum oxide trihydrate Aluminum trihydroxide Aluminum(III) hydroxide Alusal Amberol ST 140F Amorphous
pdb file: 172818.pdb sdf file: 172818.sdf directory: 172818

1344-45-2 21908-53-2 8028-34-0 AI3-02738 C.I. 77760 CI 77760 Caswell No. 544A EINECS 244-654-7 EPA Pesticide Chemical Code 052102 Gelbes quecksilberoxyd HSDB 1265 Hydrargyrum oxid flav Hydrargyrum oxydatum rubrum MERCURIC OXIDE Mercuric oxide (HgO) Mercuric oxide (red) Mercuric oxide [ISO] Mercuric oxide [Mercury and mercury compounds] Mercuric oxide, red Mercuric oxide, yellow Mercury monoxide Mercury oxide Mercury oxide (HgO) Mercury oxide [UN1641] [Poison] Mercury(2+) oxide Mercury(II) oxide Natural montroydite Oxide mercurique jaune Oxido amarillo de mercurio Oxyde de mercure [French] Oxyde mercurique [ISO-French] Red Precipitate Red mercuric oxide Red oxide of mercury Santar Santar M UN1641 Yellow mercuric oxide Yellow
pdb file: 172922.pdb sdf file: 172922.sdf directory: 172922

12263-76-2 124-43-6 12772-89-3 37211-55-5 CARBAMIDE PEROXIDE Carbamide Peroxide [USAN] Carbamide peroxide, solution EINECS 204-701-4 Hydrogen peroxide carbamide Hydrogen peroxide urea Hydrogen peroxide, compd. with urea (1:1) Hydroperit Hydroperite Hyperol Murine Ear Drops NSC 24852 Ortizon Percarbamid Percarbamide Perhydrit Perhydrol-Urea Proxigel Thenardol UN1511 Urea compound with hydrogen peroxide (1:1) Urea dioxide Urea hydrogen peroxide Urea hydrogen peroxide [UN1511] [Oxidizer] Urea hydroperoxide Urea peroxide Urea, compd. with hydrogen peroxide (1:1) Urea, compd. with hydrogen peroxide (H2O2) (1:1)
pdb file: 173351.pdb sdf file: 173351.sdf directory: 173351

2-Propenoic acid, 2-methyl-, 2-hydroxyethyl ester, homopolymer 25249-16-5 82601-55-6 Glycol methacrylate gel Hydroxymethacrylate gel PHEMA POLYHYDROXYETHYL METHACRYLATE Poly(hydroxyethyl methacrylate) Poly-hema Polyglycol methacrylate
pdb file: 174785.pdb sdf file: 174785.sdf directory: 174785

2-(2-Hydroxyaethoxy)aethylester der flutenaminsaeure [German] 2-(2-Hydroxyethoxy)ethyl N-(alpha,alpha,alpha-trifluoro-m-tolyl)anthranilate 2-(2-Hydroxyethoxy)ethyl-N-(alpha,alpha,alpha-trifluoro-m-tolyl)anthranilate 30544-47-9 Anthranilic acid, N-(alpha,alpha,alpha-trifluoro-m-tolyl)-, 2-(2-hydroxyethoxy)ethyl ester BRN 2953263 Bay d 1107 Bayrogel Benzoic acid, 2-((3-(trifluoromethyl)phenyl)amino)-, 2-(2-hydroxyethoxy)ethyl ester EINECS 250-231-8 ETOFENAMATE Etofenamate [USAN:BAN:INN] Etofenamato [INN-Spanish] Etofenamatum [INN-Latin] Rheumon Rheumon gel TVX 485 WHR 5020
pdb file: 177027.pdb sdf file: 177027.sdf directory: 177027

35306-33-3 EINECS 252-504-7 GELSEMINE HYDROCHLORIDE Gelsemine, hydrochloride Gelsemine, monohydrochloride Gesemine hydrochloride HSDB 3551
pdb file: 178523.pdb sdf file: 178523.sdf directory: 178523

1-(1,2,4-Triazoyl-1)-1-(4-chloro-phenoxy)-3,3-dimethylbutanone 1-(4-Chlorophenoxy)-3,3-dimethyl-1-(1,2,4-triazol-1-yl)-butan-2-one 1-(4-Chlorophenoxy)-3,3-dimethyl-1-(1,2,4-triazol-1-yl)butanone 1-(4-Chlorophenoxy)-3,3-dimethyl-1-(1H-1,2,4-triazol-1-yl)-2-butanone 1H-1,2,4-Triazole, 1-((tert-butylcarbonyl-4-chlorophenoxy)methyl)- 2-Butanone, 1-(4-chlorophenoxy)-3,3-dimethyl-1-(1,2,4-triazol-1-yl)- 2-Butanone, 1-(4-chlorophenoxy)-3,3-dimethyl-1-(1H-1,2,4-triazol-1-yl)- (9CI) 43121-43-3 5-26-01-00123 (Beilstein Handbook Reference) Acizol Adifon Amiral Azocene BAY 6681 F BAY-MEB-6447 BRN 0619231 Bay MEB 6447 Bayleton Bayleton BM Bayleton BM gel Bayleton CF Bayleton Total Bayleton triple Caswell No. 862AA Diametom B EINECS 256-103-8 EPA Pesticide Chemical Code 109901 HSDB 6857 Haleton MEB 6447 Mighty Miltek NSC 303303 Nurex Otria 25 Reach Rofon Strike TRIADIMEFON Tenor Triadimefon [BSI:ISO] Triadimefone Triadimefone [ISO-French] Typhon
pdb file: 180390.pdb sdf file: 180390.sdf directory: 180390

72017-58-4 CARBAMIC ACID, DIPHENYLTHIO-, S-(2-(DIETHYLAMINO)ETHYL) ESTER, 1,5-NAPHTHALENEDI Carbamic acid, diphenylthio-, S-(2-(diethylamino)ethyl) ester, 1,5-naphthalenedisulfonate Diphenylcarbamothioic acid S-(2-(diethylamino)ethyl) ester 1,5-naphthalenedisulfonate Diphenylthiocarbamic acid S-(2-(diethylamino)ethyl) ester 1,5-naphthalenedisulfonate Fencarbamide 1,5-naphthalenedisulfonate Fencarbamide napadisilate Gelosedine Phencarbamid-nds Phencarbamide 1,5-naphthalenedisulfonate Phencarbamide napadisilate S-(2-(Diethylamino)ethyl) diphenylthiocarbamate 1,5-naphthalenedisulfonate
pdb file: 189684.pdb sdf file: 189684.sdf directory: 189684

2H-Furo(2,3-h)(1)benzopyran-2-one, 4,8-dimethyl- 4,5'-Dimethyl angelicin 4,5'-Dimethylangelicin 4,5'-Dimethylangelicin plus ultraviolet A radiation [Angelicins] 4,8-DIMETHYL-2H-FURO(2,3-h)-1-BENZOPYRAN-2-ONE 4,8-Dimethylisopsoralen 4063-41-6 5-19-04-00467 (Beilstein Handbook Reference) 5-Benzofuranacrylic acid, 4-hydroxy-beta,2-dimethyl-, delta-lactone BRN 0189530
pdb file: 197591.pdb sdf file: 197591.sdf directory: 197591

12639-43-9 14987-04-3 53664-61-2 61045-54-3 61180-58-3 63800-37-3 64418-10-6 83271-15-2 Aid Plus Aid Plus G Aid Plus ML 100D Aid Plus ML 100W Aid Plus ML 50D Aid Plus ML 60D Aid Plus ML-SS Aid Plus PM Aid Plus PMC Aid Plus PMW Aid Plus S Aid Plus SP EINECS 264-465-3 Hexal 60-120 Hexal H ML 70DSA Meerschaum Milcon E Milcon LS Milcon MS 2 Milcon MS 2-2 Milcon P Milcon PS Milcon SP Milcon SS Pangel B Pangel HV Pangel S 9 Pangel ST Pansil Pansil AL 60 Quincite Sepiolite Sepiolite (Mg2H2(SiO3).xH2O) Sepiolite (Mg2H2(SiO3)3xH2O) Sepiolite (x-H2O) Sepiolite, long fibres (
pdb file: 198850.pdb sdf file: 198850.sdf directory: 198850

2H-FURO(2,3-H)(1)BENZOPYRAN-2-ONE, 5-METHYL- 4-Hydroxy-6-methyl-5-benzofuranacrylic acid gamma-lactone 5-Methyl-2H-furo(2,3-h)-1-benzopyran-2-one 5-Methylangelicin 5-Methylangelicin plus ultraviolet A radiation [Angelicins] 73459-03-7 BRN 4428822
pdb file: 199502.pdb sdf file: 199502.sdf directory: 199502

4-Chloro-2-(5-hydroxy-3-methyl-1-(3-sulfonatophenyl)pyrazole-4-ylazo)-5-methylbenzenesulfonate de calcium [French] 4-Cloro-2-(5-hidroxi-3-metil-1-(3-sulfonatofenil)pirazol-4-ilazo)-5-metilbencensulfonato de calcio [Spanish] 4-Cloro-2-(5-hidroxi-3-metil-1-(3-sulfonatofenil)pirazole-4-ilazo)-5-metilbenzenosulfonato de calcio [Portuguese] 4-Cloro-2-(5-idrossi-3-metil-1-(3-sulfonatofenil)pirazol-4-ilazo)-5-metilbenzensolfonato di calcio [Italian] Calcium 4-chloor-2-(5-hydroxy-3-methyl-1-(3-sulfonatofenyl)pyrazool-4-ylazo)-5-methylbenzeensulfonaat [Dutch] Calcium 4-chloro-2-(5-hydroxy-3-methyl-1-(3-sulfonatophenyl)pyrazol-4-ylazo)-5-methylbenzenesulfonate Calcium-4-chlor-2-(5-hydroxy-3-methyl-1-(3-sulfonatophenyl)pyrazol-4-ylazo)-5-methylbenzensulfonat [Danish] Calcium-4-chlor-2-(5-hydroxy-3-methyl-1-(3-sulfonatophenyl)pyrazol-4-ylazo)-5-methylbenzolsulfonat [German] EE4035304 PV-Echtgelb HGR
pdb file: 201553.pdb sdf file: 201553.sdf directory: 201553

3-(4-Trifluormethyl-2-nitroanilino)propaan-1,2-diol [Dutch] 3-(4-Trifluormethyl-2-nitroanilino)propan-1,2-diol [Danish] 3-(4-Trifluormethyl-2-nitroanilino)propan-1,2-diol [German] 3-(4-Trifluormetil-2-nitroanilino)propano-1,2-diol [Spanish] 3-(4-Trifluoromethyl-2-nitroanilino)propane-1,2-diol 3-(4-Trifluoromethyl-2-nitroanilino)propane-1,2-diol [French] 3-(4-Trifluorometil-2-nitroanilino)propan-1,2-diolo [Italian] 3-(4-Trifluorometil-2-nitroanilino)propano-1,2-diol [Portuguese] EE4100100 Fluorgelb
pdb file: 201997.pdb sdf file: 201997.sdf directory: 201997

10377-99-8 112414-85-4 12627-76-8 129774-17-0 1314-23-4 73649-21-5 AI3-29087 C.I. 77990 C.I. Pigment White 12 CAP (oxide) CC 10 CCRIS 6601 E 101 EINECS 215-227-2 NSC 12958 NZS 30A Nissan Zirconia Sol NZS 20A Norton 9839 Nyacol Zr (acetate) PCS (filler) Pigment White 12 Rhuligel TZ 3YTSK Torayceram Sol ZS-OA ZD 100 ZIRCONIUM OXIDE Zircoa 5027 Zirconia Zirconic anhydride Zirconium White Zirconium dioxide Zirconium oxide (VAN) Zirconium oxide (ZrO2) Zirox Zt 35
pdb file: 203702.pdb sdf file: 203702.sdf directory: 203702

(-)-Scopolamine hydrobromide trihydrate 1-alpha-H,5-alpha-H-Tropan-3-alpha-ol, 6-beta,7-beta-epoxy-, (-)-tropate (ester), hydrobromide, trihydrate 6533-68-2 6791-70-4 6beta,7beta-Epoxy-1alphaH,5alphaH-tropan-3alpha-ol (-)-tropate (ester) hydrobromide trihydrate Barbidonna Benacine Benzeneacetic acid, alpha-(hydroxymethyl)-, (1alpha,2beta,4beta,5alpha,7beta)-9-methyl-3-oxa-9-azatricyclo(3.3.1.0(sup 2,4))non-7-yl ester, hydrobromide, trihydrate, (alphaS)- Benzeneacetic acid, alpha-(hydroxymethyl)-, 9-methyl-3-oxa-9-azatricyclo(3.3.1.0(sup 2,4))non-7-yl ester, hydrobromide, trihydrate, (7(S)-(1alpha,2beta,4beta,5alpha,7beta))- CCRIS 6099 Donnagel Donnatal Donnazyme Hyoscine hydrobromide trihydrate Isopto Hyoscine Kinesed Ru-Tuss Tablets SCOPOLAMINE HYDROBROMIDE TRIHYDRATE Scopalamine hydrobromide trihydrate Scopolamine Hydrobromide [USAN] Transderm-Scop
pdb file: 204105.pdb sdf file: 204105.sdf directory: 204105

1343-98-2 20761-29-9 62647-19-2 7699-41-4 Acidum silicicum Bio-Sil EINECS 231-716-3 Kieselsaure [German] Metasilicic acid Precipitated, and gel [Silica, amorphous] Silicic acid Silicic acid (H2SiO3)
pdb file: 204173.pdb sdf file: 204173.sdf directory: 204173

22975-76-4 2H-Furo(2,3-h)(1)benzopyran-2-one, 4,9-dimethyl-, plus ultraviolet A radiation 2H-Furo(2,3-h)-1-benzopyran-2-one, 4,9-dimethyl- (8CI,9CI) 4,4'-DIMETHYLANGELICIN 4,4'-Dimethylangelicin plus ultraviolet a radiation 4,4'-Dimethylisopsoralen 4,4'-Dimethylisopsoralen plus ultraviolet a radiation 4,9-Dimethyl-2H-furo(2,3-h)-1-benzopyran-2-one plus ultraviolet a radiation 5-19-04-00467 (Beilstein Handbook Reference) BRN 0196616
pdb file: 204726.pdb sdf file: 204726.sdf directory: 204726

135151-77-8 13765-93-0 36201-72-6 37324-42-8 51668-55-4 52350-11-5 7784-30-7 8022-59-1 89686-54-4 93237-81-1 Aluminium orthophosphate, natural Aluminiumphosphat [German] Aluminophosphoric acid Aluminum acid phosphate Aluminum monophosphate Aluminum phosphate Aluminum phosphate (1:1) Aluphos EINECS 232-056-9 FFB 32 Monoaluminum phosphate Phosphaljel Phosphalugel Phosphoric acid, aluminum salt (1:1)
pdb file: 206582.pdb sdf file: 206582.sdf directory: 206582

1alphaH,5alphaH-Tropan-3alpha-ol (+-)-tropate (ester), sulfate (2:1) (salt) monohydrate 5908-99-6 Antrocol Atropine sulfate (2:1) monohydrate Atropine sulfate [USAN:JAN] Atropine sulfate hydrate Atropine sulfate monohydrate Barbidonna Benzeneacetic acid, alpha-(hydroxymethyl)-, 8-methyl-8-azabicyclo(3.2.1)oct-3-yl ester, endo-(+-)-, sulfate (2:1) (salt), monohydrate Colonaid Dasin Donnagel Donnatal Donnazyme Enlon Plus Isopto Atropine Kinesed Lomotil Mydrapred Ru-Tuss Tablets
pdb file: 206593.pdb sdf file: 206593.sdf directory: 206593

1alphaH,5alphaH-Tropan-3alpha-ol (-)-tropate (ester) sulfate (2:1) (salt) dihydrate 67008-30-4 6835-16-1 Barbidonna Benzeneacetic acid, alpha-(hydroxymethyl)-, 8-methyl-8-azabicyclo(3.2.1)oct-3-yl ester, (3(S)-endo)-, sulfate (2:1), dihydrate Donnagel Donnatal Donnazyme Hyoscyamine sulfate dihydrate Kinesed Kutrase Ru-Tuss Tablets
pdb file: 206634.pdb sdf file: 206634.sdf directory: 206634

20004-62-0 2H-Benzo(cd)pyrene-2,6(1H)-dione, 3,5,7,10-tetrahydroxy-1,1,9-trimethyl- 4-08-00-03704 (Beilstein Handbook Reference) A 3733A Antibiotic A 3733A BRN 2187224 Croceomycin Geliomycin Itamycin Resistomycin
pdb file: 207241.pdb sdf file: 207241.sdf directory: 207241

30562-34-6 BRN 1633093 Geldanamycin NSC 122750 U-29135
pdb file: 207365.pdb sdf file: 207365.sdf directory: 207365

10-(2-Dimethylaminoethyl)phenothiazine 10-(beta-Dimethylaminoethyl)phenothiazine 522-24-7 Anergell Anergen EINECS 208-325-1 Ethizine Ethysene Ethysine Ethyzine Etisin Etisine Fenetazina [DCIT] Fenethazine Fenethazine [DCF:INN] Fenethazinum [INN-Latin] Lisergan Lysergan N,N-Dimethyl-10H-phenothiazine-10-ethanamine Parkazin Phenetazine Phenethazine Phenethazinum Phenothiazine, 10-(2-(dimethylamino)ethyl)- RP 3015 Rutergan SC 1627
pdb file: 210349.pdb sdf file: 210349.sdf directory: 210349

2-Butenoic acid, 2-methyl-, (Z)- 2-Methylisocrotonic acid 565-63-9 Angelic acid Crotonic acid, 2-methyl-, (Z)- (8CI) EINECS 209-284-2 NSC 96885 cis-2-Methyl-2-butenoic acid
pdb file: 210549.pdb sdf file: 210549.sdf directory: 210549

141104-76-9 156168-97-7 156932-37-5 170006-96-9 216753-70-7 25852-47-5 62886-53-7 73212-53-0 92308-31-1 Hydrogel Poly(oxy-1,2-ethanediyl), alpha-(2-methyl-1-oxo-2-propenyl)-omega-((2-methyl-1-oxo-2 propenyl)oxy)- Poly(oxy-1,2-ethanediyl), alpha-(2-methyl-1-oxo-2-propenyl)-omega-((2-methyl-1-oxo-2-propenyl)oxy)- Polyethylene glycol dimethacrylate
pdb file: 210781.pdb sdf file: 210781.sdf directory: 210781

108736-35-2 118992-92-0 123369-01-7 127984-74-1 Angiopeptin Autogel BIM 23014 DC 13-116 L-Threoninamide, 3-(2-naphthalenyl)-D-alanyl-L-cysteinyl-L-tyrosyl-D-tryptophyl-L-lysyl-L-valyl-L-cysteinyl-, cyclic (2-7)-disulfide Lanreotida [INN-Spanish] Lanreotide Lanreotidum [INN-Latin]
pdb file: 213580.pdb sdf file: 213580.sdf directory: 213580

1330-44-5 Aldrox Algeldrate Algeldrate [USAN:INN] Algeldrato [INN-Spanish] Algeldratum [INN-Latin] Alu-Tab Alucol Aludrox Alumina hydrata Aluminium hydroxydatum colloidale Aluminiumhydroxid-gel Aluminum hydroxide hydrate Aluminum hydroxide, hydrate Hydrargillit Pepsamar Pepsitox Tonerdehydrat Trioxo-aluminium(III)-saeure W 4600
pdb file: 213597.pdb sdf file: 213597.sdf directory: 213597

23389-33-5 CCRIS 6856 Carbonic acid, magnesium salt (1:1), hydrate Carbonic acid, magnesium salt, basic Maalox HRF Magnesium Carbonate [USAN:JAN] Magnesium carbonate Magnesium carbonate (1:1) hydrate Magnesium carbonate, N-hydrate Mylanta Gelcaps
pdb file: 213608.pdb sdf file: 213608.sdf directory: 213608

2-Hydroxyethyl methacrylate polymer with methacrylic acid 2-Propenoic acid, 2-methyl-, 2-hydroxyethyl ester, polymer with 2-methyl-2-propenoic acid 2-Propenoic acid, 2-methyl-, polymer with 2-hydroxyethyl 2-methyl-2-propenoate 31693-08-0 FRE-FLEX Focofilcon A Focofilcon A [USAN] Poly(hydroxyethyl methacrylate-methacrylic acid)hydrogel
pdb file: 213646.pdb sdf file: 213646.sdf directory: 213646

1-Vinyl-2-pyrrolidinone polymer with methyl methacrylate and allyl methacrylate 2-Propenoic acid, 2-methyl-, endo- 2-Pyrrolidinone, 1-ethenyl-, polymer with methyl 2-methyl-2-propenoate and 2-propenyl 2-methyl-2-propenoate 38809-73-3 Duragel 75 Permaflex Naturals Surfilcon A Surfilcon A [USAN]
pdb file: 213680.pdb sdf file: 213680.sdf directory: 213680

1,1'-(Sulfonylbis(4,1-phenyleneimino))bis(1-deoxy-1-sulfo-D-glucitol) disodium salt 4,4'-Diamino-diphenyl-sulfon-di-D-glucosidsulfonat dinatrium [German] 4,4'-Diaminophenylsulfone-N,N-di(dextrose sodium sulfonate) 501 P 501 Siegfried 551-89-3 554-18-7 Aceprosol Angeli sulfone Angeli's sulfone D-Glucitol, 1,1'-(sulfonylbis(4,1-phenyleneimino))bis(1-deoxy-1-sulfo-, disodium salt (9CI) Disodium p,p'-diaminodiphenylsulfone-N,N'-diglucose sulfonate EINECS 209-064-6 Glucosulfone Glucosulfone (VAN) Glucosulfone [INN] Glucosulfone sodique Glucosulfone sodium Glucosulfone, disodium salt NSC 36701 NSC 512486 Promanide Promin Promin sodium Protomin S. N. 166 SN-166 Sodium glucosulfone Solfone Solfone (VAN) Sulfona P Tasmin p,p'-Diaminodiphenylsulfone-N,N'-di(dextrose sodium sulfonate) p,p'-Sulfonyldianiline N,N'-diglucoside disodium disulfonate p,p'-Sulfonyldianiline-N,N'-di-D-glucose sodium bisulfite
pdb file: 213739.pdb sdf file: 213739.sdf directory: 213739

70563-58-5 Antibiotic Tan 420F Geldanamycin, 17-demethoxy-15-methoxy-11-O-methyl-, (15R)- Herbimycin Herbimycin A NSC 305978
pdb file: 215450.pdb sdf file: 215450.sdf directory: 215450

73341-72-7 C-14919 E-1 Geldanamycin, 6,17-didemethoxy-15-methoxy-6-methyl-11-O-methyl-, (6S,15R)- (9CI) Macbecin I NSC 330499
pdb file: 215626.pdb sdf file: 215626.sdf directory: 215626

(2, 2-Dichlor-vinyl)-dimethyl-phosphat (2, 2-Dichloro-vinil)dimetil-fosfato (2,2-Dichloor-vinyl)-dimethyl-fosfaat (Dutch) 0, 0-Dimethyl 0-2,2-dichlorovinyl phosphate 2,2-Dichloroethenyl dimethyl phosphate 2,2-Dichlorovinyl dimethyl phosphate 62-73-7 AIDS-124027 AIDS124027 Algard Atgard Atgard C Atgard V BAY-19149 Bibesol Brevinyl Brevinyl E 50 Brevinyl E-50 Canogard Cekusan Chlorvinphos Cyanophos DDVF DDVP Dedevap Dichloorvo Dichlorfos(POLISH) Dichlorman Dichlorophos Dichlorovas Dichlorovos Dichlorphos Dichlorvos Dimethyl 2,2-dichloroethenyl phosphate Dimethyl 2,2-dichlorovinyl phosphate Dimethyl O, O-dichlorovinyl-2,2-phosphate Dimethyl dichlorovinyl phosphate Dimethyldichlorovinyl phosphate Divipan ENT-20738 Equigard Equigel Estrosel Ethenol, 2, 2-dichloro-, dimethyl phosphate Fecama Fekama Herkal Herkol Krecalvin Lindanmafu Marvex Mopari NCI-C00113 NSC6738 Nerkol Nogos Nogos 50 Nogos G Nuvan Nuvan 100 EC O, O-Dimethyl dichlorovinyl phosphate O,O-Dimethyl-O-(2, 2-dichlor-vinyl)-phosphat OKO
pdb file: 219969.pdb sdf file: 219969.sdf directory: 219969

7096-96-0 AIDS-125387 AIDS125387 Gelsedine NSC71050 {Spiro[3H-indole-3,7'(6'H)-[3,} {6]methano[1H]oxepino[4,3-b]pyrrol]-2(1H)-one,} 2'-ethyl-2',3',3'a, 4',8',8'a-hexahydro-1-methoxy- {Spiro[3H-indole-3,7'(6'H)-[3,} {6]methano[1H]oxepino[4,3-b]pyrrol]-2(1H)-one,} 2'-ethyl-2',3',3'a, 4',8',8'a-hexahydro-1-methoxy-, {[2'R-(2'.alpha.,3'.alpha.,} 3'a.beta.,6'.alpha.,7'.alpha.,8'a.beta.)\]-
pdb file: 221327.pdb sdf file: 221327.sdf directory: 221327

13-Hydroxy-8,14,19-trimethoxy-4,10,12,16-tetramethyl-3,20,22-trioxo-21-((1-piperidinylimino)methyl)-2-azabicyclo[16.3.1]docosa-1(21),4,6,10,18-pentaen-9-yl carbamate 19-Formylgeldanamycin N-piperidinoimine 19-Formylgeldanamycin-N', N'-pentamethylenehydrazone 65764-44-5 AIDS-128292 AIDS128292 NSC255111
pdb file: 224230.pdb sdf file: 224230.sdf directory: 224230

17-Des-O-methyl-17-cyclopropylamino-geldanamycin 19-(Cyclopropylamino)-13-hydroxy-8,14-dimethoxy-4,10,12,16-tetramethyl-3,20,22-trioxo-2-azabicyclo[16.3.1]docosa-1(21),4,6,10,18-pentaen-9-yl carbamate 71952-91-5 AIDS-129022 AIDS129022 GELDANAMYCIN DERIV NSC320876
pdb file: 224960.pdb sdf file: 224960.sdf directory: 224960

90826-58-7 AIDS-130181 AIDS130181 Angelicolide Dispiro[isobenzofuran-1(3H),1'-cyclobutane-2',1''(3''H)-isobenzofuran]-3,3''-dione, 6,6'',7,7''-tetrahydro-3',4'-dipropyl- NSC382182
pdb file: 226130.pdb sdf file: 226130.sdf directory: 226130

1,2,5,5-Tetramethyl-1-(3-methyl-5-(3-methyl-6-(methylimino)-3,6-dihydro-7H-purin-7-yl)-3-pentenyl)octahydro-4a(2H)-naphthalenol AIDS-132365 AIDS132365 Agelasimine A NSC625921
pdb file: 228313.pdb sdf file: 228313.sdf directory: 228313

(-)-Agelasidine C AIDS-140463 AIDS140463 N-(2-((3,7-Dimethyl-9-(1,2,6-trimethyl-2-cyclohexen-1-yl)-2,6-nonadienyl)sulfonyl)ethyl)guanidine NSC652526
pdb file: 236411.pdb sdf file: 236411.sdf directory: 236411

(-)-Agelasidine D AIDS-140464 AIDS140464 N-(2-((3-(Hydroxymethyl)-7-methyl-9-(1,2,6-trimethyl-2-cyclohexen-1-yl)-2,6-nonadienyl)sulfonyl)ethyl)guanidine NSC652527
pdb file: 236412.pdb sdf file: 236412.sdf directory: 236412

2-Butenoic acid, 2-methyl-, (Z)- 565-63-9 Angelic acid Crotonic acid, 2-methyl-, (Z)- NSC96885 cis-2-Methyl-2-butenoic acid
pdb file: 401211.pdb sdf file: 401211.sdf directory: 401211

9002-89-5 Alcotex 17F-H Alcotex 88/05 Alcotex 88/10 Alcotex 99/10 Alkotex Alvyl Aracet APV Cipoviol W 72 Covol Covol 971 EP 160 Elvanol Elvanol 50-42 Elvanol 51-05G Elvanol 5105 Elvanol 52-22 Elvanol 52-22G Elvanol 522-22 Elvanol 70-05 Elvanol 71-30 Elvanol 73125G Elvanol 90-50 Elvanol T 25 Enbra OV Ethenol, homopolymer FH 1500 GH 20 GL 02 GL 03 GLO 5 GM 14 Gelvatol Gelvatol 1-30 Gelvatol 1-60 Gelvatol 1-90 Gelvatol 20-30 Gelvatol 2060 Gelvatol 2090 Gelvatol 3-91 Gohsenol Gohsenol AH 22 Gohsenol GH Gohsenol GH 17 Gohsenol GH 20 Gohsenol GH 23 Gohsenol GL 03 Gohsenol GL 05 Gohsenol GL
pdb file: 407614.pdb sdf file: 407614.sdf directory: 407614

103-90-2 4'-Hydroxyacetanilide 4-Acetamidophenol 4-Acetaminophenol 4-Hydroxyacetanilide APAP Abensanil Acamol Accu-Tap Acetagesic Acetalgin Acetamide, N-(4-hydroxyphenyl)- Acetamide, N-(p-hydroxyphenyl)- Acetaminofen Acetaminophen Acetanilide, 4'-hydroxy- Algotropyl Alpiny Alvedon Amadil Anaflon Anapap Anelix Anhiba Apadon Apamid Apamide Ben-u-ron Bickie-mol Calpol Cetadol Clixodyne Conacetol Datril Dial-A-Gesic Dimindol Dirox Dularin Dymadon Dypap Elixodyne Eneril Febridol Febrilix Febrinol Febro-Gesic Febrolin Fendon Fevor Finimal G 1 G-1 Gelocatil Hedex Homoolan Injectapap Janupap Korum Lestemp Liquagesic Lonarid Lyteca Lyteca Syrup Multin N-(4-Hydroxyphenyl)acetamide N-Acetyl-4-aminophenol N-Acetyl-p-aminophenol NAPA NAPAP NCI-C55801 NSC109028 Napafen Naprinol Nealgyl Nebs Neotrend Nobedon Pacemo Painex Panadol Panets Paracet Paracetamol Paracetamol DC Paracetamole Paracetanol Parapan Parmol Pedric Phendon Phenol, p-acetamido- Prompt
pdb file: 408305.pdb sdf file: 408305.sdf directory: 408305

2-Propenamide, homopolymer 9003-05-8 AP 273 Acrylamide homopolymer Acrylamide polymer Acrylamide polymers Acrylamide, polymer Acrylamide, polymers Aerofloc 3453 American Cyanamid KPAM American Cyanamid P-250 Aminogen PA Bio-Gel P 2 BioGel P-100 Cyanamer P 250 Cyanamer P 35 Cytame 5 Dow ET 597 Dow J 100 ET 597 Flokonit E Flygtol GB Gelamide 250 Himoloc OK 507 Himoloc SS 200 J 100 J 100 (polymer) K 4 (acrylic polymer) K-PAM Magnafloc R 292 NSC116573 Nacolyte 673 P 250 P 250 (polymer) P 300 PAA 1 (homopolymer) PAA 70L PAA-1 PAA-25 PAARK 123sh PAM PAM (polymer) PAM-50 Pamid Percol 720 Polyacrylamide Polyacrylamide
pdb file: 412405.pdb sdf file: 412405.sdf directory: 412405

2-Propenamide, homopolymer 9003-05-8 AP 273 Acrylamide homopolymer Acrylamide polymer Acrylamide polymers Acrylamide, polymer Acrylamide, polymers Aerofloc 3453 American Cyanamid KPAM American Cyanamid P-250 Aminogen PA Bio-Gel P 2 BioGel P-100 Cyanamer P 250 Cyanamer P 35 Cytame 5 Dow ET 597 Dow J 100 ET 597 Flokonit E Flygtol GB Gelamide 250 Himoloc OK 507 Himoloc SS 200 J 100 J 100 (polymer) K 4 (acrylic polymer) K-PAM Magnafloc R 292 NSC116574 Nacolyte 673 P 250 P 250 (polymer) P 300 PAA 1 (homopolymer) PAA 70L PAA-1 PAA-25 PAARK 123sh PAM PAM (polymer) PAM-50 Pamid Percol 720 Polyacrylamide Polyacrylamide
pdb file: 412406.pdb sdf file: 412406.sdf directory: 412406

2-Propenamide, homopolymer 9003-05-8 AP 273 Acrylamide homopolymer Acrylamide polymer Acrylamide polymers Acrylamide, polymer Acrylamide, polymers Aerofloc 3453 American Cyanamid KPAM American Cyanamid P-250 Aminogen PA Bio-Gel P 2 BioGel P-100 Cyanamer P 250 Cyanamer P 35 Cytame 5 Dow ET 597 Dow J 100 ET 597 Flokonit E Flygtol GB Gelamide 250 Himoloc OK 507 Himoloc SS 200 J 100 J 100 (polymer) K 4 (acrylic polymer) K-PAM Magnafloc R 292 NSC116575 Nacolyte 673 P 250 P 250 (polymer) P 300 PAA 1 (homopolymer) PAA 70L PAA-1 PAA-25 PAARK 123sh PAM PAM (polymer) PAM-50 Pamid Percol 720 Polyacrylamide Polyacrylamide
pdb file: 412407.pdb sdf file: 412407.sdf directory: 412407

2-Propenamide, homopolymer 9003-05-8 AP 273 Acrylamide homopolymer Acrylamide polymer Acrylamide polymers Acrylamide, polymer Acrylamide, polymers Aerofloc 3453 American Cyanamid KPAM American Cyanamid P-250 Aminogen PA Bio-Gel P 2 BioGel P-100 Cyanamer P 250 Cyanamer P 35 Cytame 5 Dow ET 597 Dow J 100 ET 597 Flokonit E Flygtol GB Gelamide 250 Himoloc OK 507 Himoloc SS 200 J 100 J 100 (polymer) K 4 (acrylic polymer) K-PAM Magnafloc R 292 NSC118185 Nacolyte 673 P 250 P 250 (polymer) P 300 PAA 1 (homopolymer) PAA 70L PAA-1 PAA-25 PAARK 123sh PAM PAM (polymer) PAM-50 Pamid Percol 720 Polyacrylamide Polyacrylamide
pdb file: 413460.pdb sdf file: 413460.sdf directory: 413460

2-Azabicyclo[16.3.1]docosa-4,6,10,18,21-pentaene- 3,20,22-trione, 9,13-dihydroxy-8,14,19-trimethoxy- 4,10,12,16-tetramethyl-, 9-carbamate 30562-34-6 Antibiotic (U-29,135) Antibiotic U 29135 GELDANAMYCIN Geldanamicin NSC122750
pdb file: 416395.pdb sdf file: 416395.sdf directory: 416395

131-69-1 4'-(Acetylsulfamoyl)phthalanilic acid 4'-(Acetylsulfamyl)phthalanilic acid Benzoic acid, 2-[[[4-[(acetylamino)sulfonyl]phenyl]amino]carbonyl]- Enterocid Enterosulfamid Enterosulfon Enterosulphamid Ftalicetimida Kalacet N(sup1)-Acetyl-N(sup4)-phthalylsulfanilamide N-(o-Carboxybenzoyl)sulfacetamide NSC163977 Phthalanilic acid, 4'-(acetylsulfamoyl)- Phthaloylsulfacetamide Phthalylsulfacetamide Phthalylsulfacetimide Phthalylsulphacetamide Phthalylthioacetamide Rabalan Sterathal Sulphalyl TSC-80 TSC-80 Medicated Talasulfa Talecid Talicetimida Talsigel Talsutin Tamid Thalajen Thalamyd Thalisul Thalocid
pdb file: 438605.pdb sdf file: 438605.sdf directory: 438605

(Phenylmethyl)penicillin (Phenylmethyl)penicillinic acid 4-Thia-1-azabicyclo[3.2.0]heptane-2-carboxylic acid, 3,3-dimethyl-7-oxo-6-(2-phenylacetamido)- 4-Thia-1-azabicyclo[3.2.0]heptane-2-carboxylic acid, 3,3-dimethyl-7-oxo-6-[(phenylacetyl)amino]- [2S-(2.alpha.,5.alpha.,6.beta.)]- 61-33-6 Abbocillin Benzopenicillin Benzyl-6-aminopenicillinic acid Benzylpenicillin Benzylpenicillin G Benzylpenicillinic acid Cilloral Cilopen Compocillin G Cosmopen Dropcillin Free benzylpenicillin Free penicillin G Free penicillin II Galofak Gelacillin Liquacillin NSC193396 Penicillin Penicillin G Penicillin, (phenylmethyl)- Penicillinic acid, (phenylmethyl)- Penicillinic acid, benzyl- Pentids Pharmacillin Phenylacetamidopenicillanic acid Pradupen Specilline G WLN: T45 ANV ESTJ CMV1R& F F GVQ
pdb file: 449427.pdb sdf file: 449427.sdf directory: 449427

90826-58-7 Angelicolide NSC382182
pdb file: 470782.pdb sdf file: 470782.sdf directory: 470782

89412-79-3 Isolate from Anemone raddeana regel NSC382873 Raddeanin A
pdb file: 471074.pdb sdf file: 471074.sdf directory: 471074

2-Propenoic acid, 3-(4-hydroxy-5-benzofuranyl)-, .delta.-lactone 2H-Furo[2,3-h]-1-benzopyran-2-one 523-50-2 Angecin Angelicin Angelicin (coumarin derivative) Furo[5',4':7,8]coumarin Isopsoralen NSC404563
pdb file: 474744.pdb sdf file: 474744.sdf directory: 474744

.beta.-Methylesculetin 2H-1-Benzopyran-2-one, 7-hydroxy-6-methoxy- 6-Methoxy-7-hydroxycoumarin 6-Methylesculetin 7-Hydroxy-6-methoxycoumarin 92-61-5 Chrysatropic acid Coumarin, 7-hydroxy-6-methoxy- Gelseminic acid Murrayetin NSC405647 SCOPOLETIN Scopoletine Scopoletol
pdb file: 475672.pdb sdf file: 475672.sdf directory: 475672

1-Tridecanecarboxylic acid, isopropyl ester 110-27-0 Bisomel Crodamol I.P.M. Crodamol IPM Deltyl Extra Emcol-IM Emerest 2314 Estergel Isomyst Isopropyl Myristate Isopropyl tetradecanoate Ja-fa IPM Kessco IPM Kessco isopropyl myristate Kesscomir Myristic acid, isopropyl ester NSC406280 Plymoutm IPM Promyr Sinnoester MIP Starfol IPM Stepan D-50 Tegester Tetradecanoic acid, 1-methylethyl ester Tetradecanoic acid, isopropyl Tetradecanoic acid, isopropyl ester Unimate IPM WLN: 13VOY1&1 Wickenol 101 component of Sardo Bath Oil
pdb file: 476199.pdb sdf file: 476199.sdf directory: 476199

3,3',4',7-Tetrahydroxyflavone 4H-1-Benzopyran-4-one, 2-(3,4-dihydroxyphenyl)-3,7-dihydroxy- 5-Desoxyquercetin 528-48-3 Bois bleu de Honqrie C.I. 75620 C.I. Natural Brown 1 Cotinin FISETIN Fietin Fisetholz Flavone, 3,3',4',7-tetrahydroxy- Fustel Fustet Junger Fustik NSC407010 Superfustel Superfustel K Ungarisches Gelbholz Ventin Sumach Viset Young Fustic Young Fustic Crystals Zante Fustic
pdb file: 476876.pdb sdf file: 476876.sdf directory: 476876

1,3,8-Trihydroxy-6-methyl-9,10-anthraquinone 1,3,8-Trihydroxy-6-methylanthraquinone 3-Methyl-1,6,8-trihydroxyanthraquinone 4,5,7-Trihydroxy-2-methylanthraquinone 518-82-1 9,10-Anthracenedione, 1,3,8-trihydroxy-6-methyl- Anthraquinone, 1,3,8-trihydroxy-6-methyl- C.I. 75440 C.I. Natural Yellow 14 EMODIN Emodol Frangula emodin NSC408120 Persian Berry Lake Rheum emodin Schuttgelb
pdb file: 477762.pdb sdf file: 477762.sdf directory: 477762

Agelasine NSC622158
pdb file: 490519.pdb sdf file: 490519.sdf directory: 490519

Agelasimine A NSC625921
pdb file: 492746.pdb sdf file: 492746.sdf directory: 492746

12-Deoxyphorbol 13-angelate NSC632856
pdb file: 496057.pdb sdf file: 496057.sdf directory: 496057

(-)-Agelasidine C NSC652526
pdb file: 505719.pdb sdf file: 505719.sdf directory: 505719

(-)-Agelasidine D NSC652527
pdb file: 505720.pdb sdf file: 505720.sdf directory: 505720

GAB-GELDANAMYCIN Geldanamycin 4-aminobutyrate hydrochloride NSC658514
pdb file: 508344.pdb sdf file: 508344.sdf directory: 508344

2-Azabicyclo[16.3.1]docasa-4,6,10,18,21-pentaene- 3,20,23-trione, 13-(3-aminopropionyloxy)-9,13-dihydroxy- 8,14,19-trimethoxy-4,10,12,16-tetramethyl-, 9-carbamate,monohydrochloride 2-Azabicyclo[16.3.1]docosane, geldanamycin deriv. Geldanamycin, 12-(3-aminopropionate)-monohydrochloride NSC661581
pdb file: 509764.pdb sdf file: 509764.sdf directory: 509764

7-Angelyl-1-methylene-pyrrolizidine NSC669362
pdb file: 513141.pdb sdf file: 513141.sdf directory: 513141

17-Demethoxy-17-N-allyamino-geldanamycin 11-(4'-aminobutyrate) hydrochloride NSC683201
pdb file: 519620.pdb sdf file: 519620.sdf directory: 519620

17-Demethoxy-17-allylamino geldanamycin-11-[4-(dimethylamino)butyrate] NSC697886
pdb file: 525729.pdb sdf file: 525729.sdf directory: 525729

17-DMAG 2-Azabicyclo[16.3.1]docosa-4,6,10,18,21-pentaene-3,20,22- trione, 9-[(aminocarbonyl)oxy]-19-[[2-(dimethylamino) ethyl]amino]-13-hydroxy-8,14-dimethoxy-4,10,12,16- tetramethyl-, hydrochloride, stereoisomer Geldanamycin, 17-demethoxy-17-[[2-(dimethylamino)ethyl]amino]-, monohydrochloride NSC707545
pdb file: 529444.pdb sdf file: 529444.sdf directory: 529444

17-n-Propylamino-geldanamycin NSC662199
pdb file: 536419.pdb sdf file: 536419.sdf directory: 536419

55-68-5 Mercuriphenyl nitrate Mercury, (nitrato-O)phenyl- Mercury, nitratophenyl- Merpectogel Merphenyl nitrate Mersolite 7 NSC4772 Nitratophenylmercury Nitric acid, phenylmercury salt Phe-Mer-Nite Phenalco Phenitol Phenmerzyl nitrate Phenyl(II) nitrate Phenylmercuric nitrate Phenylmercurinitrate Phenylmercury nitrate Phermernite WLN: WNO-HG-R
pdb file: 538895.pdb sdf file: 538895.sdf directory: 538895

1-Cetylpyridinium chloride 1-Hexadecylpyridinium chloride 123-03-5 Acetoquat CPC Aktivex Ammonyx CPC Biosept Ceepryn Chloride Cepacol Cepacol chloride Ceprim Cetamium Cetyl-pyridinium chloride Cetylpyridinium chloride Dobendan Hexadecylpyridinium chloride Intexsan CPC N-Cetylpyridinium chloride N-Hexadecylpyridinium chloride NSC14864 Pristacin Pyridinium, 1-hexadecyl-, chloride Pyrisept Quaternario CPC Swabettes Hoechst Tserigel WLN: T6KJ A16 & Q & G
pdb file: 540790.pdb sdf file: 540790.sdf directory: 540790

509-15-9 GELSEMINE Gelsemin NSC21729 Spiro[3,5,8-ethanylylidene-1H-pyrano[3,4-c]pyridine-10,3'-[3H]indol]-2'(1'H)-one, 5-ethenyl-3,4,4a,5,6,7,8,8a-octahydro-7-methyl- Spiro[3,5,8-ethanylylidene-1H-pyrano[3,4-c]pyridine-10,3'-[3H]indol]-2'(1'H)-one, 5-ethenyl-3,4,4a,5,6,7,8,8a-octahydro-7-methyl-, [3R-(3.alpha.,4a.beta.,5.alpha.,8.alpha.,8a.beta.,9S*,10S*)]-
pdb file: 541971.pdb sdf file: 541971.sdf directory: 541971

1,1'-[Sulfonylbis(4,1-phenyleneimino)]bis[1-deoxy-1-sulfo-D-glucitol] disodium salt 501 P 501 Siegfried 554-18-7 Aceprosol Angeli sulfone Angeli's sulfone D-Glucitol, 1,1'-[sulfonylbis(4,1-phenyleneimino)]bis[1-deoxy-1-sulfo-, disodium salt Disodium p,p'-(diaminodiphenyl)sulfone-N,N'-diglucose sulfonate Glucitol, 1,1'-[sulfonylbis(4,1-phenyleneimino)]bis[1-deoxy-1-sulfo-, disodium salt, D- Glucosulfone Glucosulfone sodium Glucosulfone, disodium salt NSC36701 Promanide Promin Promin sodium Protomin S. N. 166 SN-166 Sodium glucosulfone Sodium glucosulfone, injection Solfone Sulfona P Tasmin p,p'-(Diaminodiphenyl)sulfone-N,N'-di(dextrose sodium sulfonate) p,p'-Sulfonyldianiline N,N'-diglucoside disodium disulfonate p,p'-Sulfonyldianiline, N,N'-diglucoside disodium disulfonate p,p'-Sulfonyldianiline-N,N'-di-D-glucose sodium bisulfite
pdb file: 545020.pdb sdf file: 545020.sdf directory: 545020

1-(1-Phenylcyclohexyl)piperidine hydrochloride 956-90-1 Angel dust C.I. 395 CI-395 CN-25,253-2 Cl 395 hydrochloride DOA Elephant tranquilizer Elysion GP 121 GP-121 HOG NSC40902 PHENCYLIDINE HYDROCHLORIDE Pcp Peace pill Phencyclidine Hydrochloride Phenylcyclidine hydrochloride Piperidine, 1-(1-phenylcyclohexyl)-, hydrochloride Sernyl Sernyl hydrochloride Sernylan Trank WLN: T6NTJ A- AL6TJ AR &GH
pdb file: 545956.pdb sdf file: 545956.sdf directory: 545956

GELSEMICINE NSC71051
pdb file: 550084.pdb sdf file: 550084.sdf directory: 550084

13765-19-0 C.I. 77223 Calcium chromate Calcium chromate (CaCrO4) Calcium chromate (VI) Calcium chrome yellow Calcium chromium oxide Calcium chromium oxide (CaCrO4) Calcium monochromate Chromatite syn Chromic acid (H2CrO4), calcium salt (1:1) Chromic acid, calcium salt (1:1) Gelbin NSC176337 WLN: CA CR-O4 Yellow ultramarine
pdb file: 564107.pdb sdf file: 564107.sdf directory: 564107

30562-34-6 Antibiotic (U-29,135) Antibiotic U 29135 GELDANAMYCIN Geldanamicin NSC212518
pdb file: 566598.pdb sdf file: 566598.sdf directory: 566598

17-Amino-17-demethoxygeldanamycin 17-Aminodemethoxygeldanamycin 64202-81-9 GELDANAMYCIN ANALOG Geldanamycin, 17-amino-17-demethoxy- NSC255109
pdb file: 569254.pdb sdf file: 569254.sdf directory: 569254

7'&8'-Chlorodemethoxygeldanazine NSC260177
pdb file: 569468.pdb sdf file: 569468.sdf directory: 569468

7'+8'-Fluorodemethoxygeldanazine NSC260178
pdb file: 569469.pdb sdf file: 569469.sdf directory: 569469

Methyl 17-amino-17-demethoxygeldanamycinate NSC265481
pdb file: 569808.pdb sdf file: 569808.sdf directory: 569808

19-Formylgeldanamycin N',N'-dibutylhydrazone 65764-47-8 NSC265482 VL GELD 33
pdb file: 569809.pdb sdf file: 569809.sdf directory: 569809

17-Des-O-methyl-17-cyclopropylamino-geldanamycin 71952-91-5 GELDANAMYCIN DERIV NSC320876
pdb file: 574213.pdb sdf file: 574213.sdf directory: 574213

71952-92-6 GELDANAMYCIN DERIV Geldanamycin, 17-[(2-chloroethyl)amino]-17-demethoxy- NSC320877
pdb file: 574214.pdb sdf file: 574214.sdf directory: 574214

2-Azabicyclo[16.3.1]docosane, geldanamycin deriv. 73341-72-7 Geldanamycin, 6,17-didemethoxy-15-methoxy-6-methyl-11-O-methyl-, (6S,15R)- MACBECIN I NSC330499
pdb file: 574815.pdb sdf file: 574815.sdf directory: 574815

2-Azabicyclo[16.3.1]docosane, geldanamycin deriv. 73341-73-8 Geldanamycin, 18,21-didehydro-6,17-didemethoxy-18,21-dideoxo-18,21-dihydroxy-15-methoxy-6-methyl-11-O-methyl- Geldanamycin, 18,21-didehydro-6,17-didemethoxy-18,21-dideoxo-18,21-dihydroxy-15-methoxy-6-methyl-11-O-methyl-, (6S,15R)- MACBECIN II NSC330500
pdb file: 574816.pdb sdf file: 574816.sdf directory: 574816

17-AAG 2-Azabicyclo[16.3.1]docosane, geldanamycin deriv. 75747-14-7 CP 127374 GLD-36 Geldanamycin, 17-allylamino-17-demethoxy- Geldanamycin, 17-demethoxy-17-(2-propenylamino)- Geldanamycin, des-O-methyl-17-allylamino- NSC330507
pdb file: 574817.pdb sdf file: 574817.sdf directory: 574817

75747-32-9 GELDANAMYCIN, N,N'-DIMETHYL GLD-91-III NSC330512
pdb file: 574818.pdb sdf file: 574818.sdf directory: 574818

ANGELYLGRANDIFLORIC ACID Angeloxygrandifloric acid NSC360852
pdb file: 576635.pdb sdf file: 576635.sdf directory: 576635

1,1'-[Sulfonylbis(4,1-phenyleneimino)]bis[1-deoxy-1-sulfo-D-glucitol] disodium salt 501 P 501 Siegfried 554-18-7 Aceprosol Angeli sulfone Angeli's sulfone D-Glucitol, 1,1'-[sulfonylbis(4,1-phenyleneimino)]bis[1-deoxy-1-sulfo-, disodium salt Disodium p,p'-(diaminodiphenyl)sulfone-N,N'-diglucose sulfonate Glucitol, 1,1'-[sulfonylbis(4,1-phenyleneimino)]bis[1-deoxy-1-sulfo-, disodium salt, D- Glucosulfone Glucosulfone sodium Glucosulfone, disodium salt NSC512486 Promanide Promin Promin sodium Protomin S. N. 166 SN-166 Sodium glucosulfone Sodium glucosulfone, injection Solfone Sulfona P Tasmin p,p'-(Diaminodiphenyl)sulfone-N,N'-di(dextrose sodium sulfonate) p,p'-Sulfonyldianiline N,N'-diglucoside disodium disulfonate p,p'-Sulfonyldianiline, N,N'-diglucoside disodium disulfonate p,p'-Sulfonyldianiline-N,N'-di-D-glucose sodium bisulfite
pdb file: 579740.pdb sdf file: 579740.sdf directory: 579740

(3R,3aS,4R,6R,7R,9S,9bR)-6,7,9-trihydroxy-3,6,9-trimethyl-2-oxo-2,3,3a,4,5,6,7,8,9,9b-decahydroazuleno[4,5-b]furan-4-yl rel-(2Z)-2-methylbut-2-enoate 2-Methyl-but-2-enoic acid 6,7,9-trihydroxy-3,6,9-trimethyl-2-oxo-2,3,3a,4,5,6,7,8,9,9b-decahydro-azuleno[4,5-b]furan-4-yl ester 2-butenoic acid, 2-methyl-, (3aR,4S,6S,7S,9R,9bS)-2,3,3a,4,5,6,7,8,9,9b-decahydro-6,7,9-trihydroxy-3,6,9-trimethyl-2-oxoazuleno[4,5-b]furan-4-yl ester, (2Z)- 8alpha-Angeloxy-2alpha,4alpha,10beta-trihydroxy-6betaH,7alphaH,11betaH-1(5)-guaien-12,6alpha-olide InChI=1/C20H28O7/c1-6-9(2)17(22)26-12-8-20(5,25)14-11(21)7-19(4,24)15(14)16-13(12)10(3)18(23)27-16/h6,10-13,16,21,24-25H,7-8H2,1-5H3/b9-6-/t10-,11-,12-,13+,16-,19+,20-/m0/s
pdb file: 585398.pdb sdf file: 585398.sdf directory: 585398

(3R)-5,7-dihydroxy-4'-methoxy-6,3'-di(3-methylbut-2-enyl)isoflavone 4H-1-benzopyran-4-one, 2,3-dihydro-5,7-dihydroxy-3-[4-methoxy-3-(3-methyl-2-butenyl)phenyl]-6-(3-methyl-2-butenyl)-, (3R)- 5,7-Dihydroxy-3-[4-methoxy-3-(3-methyl-but-2-enyl)-phenyl]-6-(3-methyl-but-2-enyl)-chroman-4-one 5,7-dihydroxy-3-[4-methoxy-3-(3-methylbut-2-en-1-yl)phenyl]-6-(3-methylbut-2-en-1-yl)-2,3-dihydro-4H-chromen-4-one InChI=1/C26H30O5/c1-15(2)6-8-18-12-17(9-11-22(18)30-5)20-14-31-23-13-21(27)19(10-7-16(3)4)25(28)24(23)26(20)29/h6-7,9,11-13,20,27-28H,8,10,14H2,1-5H3/t20-/m0/s Vogelin D
pdb file: 585721.pdb sdf file: 585721.sdf directory: 585721

(1R,2S,3S,4R,5S,6S)-2,3,6-trihydroxy-4,5-bis[(2-methylbutanoyl)oxy]cyclohexyl rel-(2Z)-2-methylbut-2-enoate 2-Methyl-but-2-enoic acid 2,3,6-trihydroxy-4,5-bis-(2-methyl-butyryloxy)-cyclohexyl ester 2-butenoic acid, 2-methyl-, (1S,2R,3R,4S,5R,6R)-2,3,6-trihydroxy-4,5-bis(2-methyl-1-oxobutoxy)cyclohexyl ester, (2Z)- 6-Angeloyl-2,3-dimethylbutanoyl-myoinositol InChI=1/C21H34O9/c1-7-10(4)19(25)28-16-13(22)14(23)17(29-20(26)11(5)8-2)18(15(16)24)30-21(27)12(6)9-3/h7,11-18,22-24H,8-9H2,1-6H3/b10-7-/t11?,12?,13-,14-,15-,16+,17+,18-/m1/s
pdb file: 585814.pdb sdf file: 585814.sdf directory: 585814

2H-furo[2,3-h]-1-benzopyran-2-one, 5-(3-hydroxy-3-methyl-2-oxobutyl)-6-methoxy- 5-(3-Hydroxy-3-methyl-2-oxo-butyl)-6-methoxy-furo[2,3-h]chromen-2-one 5-(3-hydroxy-3-methyl-2-oxobutyl)-6-methoxy-2H-furo[2,3-h]chromen-2-one 6-Methoxy-5-(3-hydroxy-2-oxo-3-methyl-butyl)-angelicin InChI=1/C17H16O6/c1-17(2,20)12(18)8-11-9-4-5-13(19)23-14(9)10-6-7-22-16(10)15(11)21-3/h4-7,20H,8H2,1-3H
pdb file: 586076.pdb sdf file: 586076.sdf directory: 586076

(5beta,7beta,8alpha,9beta,10alpha,13alpha,15alpha)-7,9-dihydroxy-15-{[(2Z)-2-methylbut-2-enoyl]oxy}kaur-16-en-18-oic acid InChI=1/C25H36O6/c1-6-14(2)20(27)31-19-15(3)16-8-11-25(30)23(5)10-7-9-22(4,21(28)29)17(23)12-18(26)24(19,25)13-16/h6,16-19,26,30H,3,7-13H2,1-2,4-5H3,(H,28,29)/b14-6-/t16?,17-,18+,19+,22-,23-,24-,25-/m1/s ent-15beta-Angeloyloxy-7alpha,9alpha-dihydroxy-kaur-16-en-19-oic acid ergosta-2,5,24-triene-1,26-dione, 22,26-epoxy-20-hydroxy-, (22R)-
pdb file: 586251.pdb sdf file: 586251.sdf directory: 586251

2H-furo[2,3-h]-1-benzopyran-2-one, 5-fluoro- 5-Fluoro-2H-furo[2,3-h]-1-benzofuran-2-one 5-Fluoro-furo[2,3-h]chromen-2-one 5-Fluoroangelicin 5-fluoro-2H-furo[2,3-h]chromen-2-one InChI=1/C11H5FO3/c12-8-5-9-7(3-4-14-9)11-6(8)1-2-10(13)15-11/h1-5
pdb file: 586358.pdb sdf file: 586358.sdf directory: 586358

(1R,2S,3aR,6R,7S,7aR)-1-acetyl-6-(acetyloxy)-7-isopropyl-4-methyleneoctahydro-1H-inden-2-yl rel-(2Z)-2-methylbut-2-enoate 2-Methyl-but-2-enoic acid 6-acetoxy-1-acetyl-7-isopropyl-4-methylene-octahydro-inden-2-yl ester 2-butenoic acid, 2-methyl-, (1R,2S,3aR,6R,7S,7aR)-1-acetyl-6-(acetyloxy)octahydro-4-methylene-7-(1-methylethyl)-1H-inden-2-yl ester, (2Z)- 3-Angeloyloxy-8-acetoxy-10(14)-oplopen-4-one InChI=1/C22H32O5/c1-8-12(4)22(25)27-18-10-16-13(5)9-17(26-15(7)24)19(11(2)3)21(16)20(18)14(6)23/h8,11,16-21H,5,9-10H2,1-4,6-7H3/b12-8-/t16-,17+,18-,19+,20-,21+/m0/s
pdb file: 587516.pdb sdf file: 587516.sdf directory: 587516

26299-60-5 (ACRYLIC ACID-SULFATED VINYL ALCOHOL COPOLYMER, SODIUM SALTS) AIDS-000603 AIDS000603 Igetagel P Kurasutoma AP 22 PAVAS Poly(acrylic acid vinyl alcohol) Poval SPC 20A S 50 Sulfated copolymer of acrylic acid with vinyl alcohol Sulfated vinyl alcohol-acrylic acid copolymer
pdb file: 595239.pdb sdf file: 595239.sdf directory: 595239

AIDS-003385 AIDS003385 GAP 31 GAP31 GLDTVSFSTKGATYITYVNFLNELRVKTKPEGNSHGIPSLRKSSDDPGSSFVVAG Gelonium Anti-HIV Protein 31
pdb file: 597820.pdb sdf file: 597820.sdf directory: 597820

AIDS-005032 AIDS005032 AVGIGALFLGFLGAAGSTMGAK & carrier Gel-SucOsu AVGIGALFLGFLGAAGSTMGAK conjugated with Gel-SucOsu
pdb file: 600692.pdb sdf file: 600692.sdf directory: 600692

AIDS-005033 AIDS005033 AVGIGALFLGFLGAAGSTMGAK & carrier Gel-SucOsu AVGIGALFLGFLGAAGSTMGAK conjugated with Gel-SucOsu
pdb file: 600693.pdb sdf file: 600693.sdf directory: 600693

(3R*,4S*,5S*,6R*,7R*,9R*,11R*,12R*,13S*,14R*)-4-[(2,6-Dideoxy-3-C-methyl-3-O-methyl-.alpha.-L-ribo-hexopyranosyl)oxy]-14-ethyl-7,12,13-trihydroxy-3,5,9,11,13-hexamethyl-6-[[3,4,6-trideoxy-3- 114-07-8 AIDS-007674 AIDS007674 Emgel Erymax Erythro Erythromycin Ilotycin
pdb file: 602904.pdb sdf file: 602904.sdf directory: 602904

64202-83-1 7'-Bromodemethoxy geldanoxazone 7'-Bromodemethoxygelanoxazone AIDS-010668 AIDS010668 NSC255105
pdb file: 604704.pdb sdf file: 604704.sdf directory: 604704

(6S,15R)-6,17-Didemethoxy-15-methoxy-6-methyl-11-O- methyl, geldanamycin 73341-72-7 AIDS-010673 AIDS010673 Geldanamycin, 6,17-didemethoxy-15-methoxy-6-methyl-11-O-methyl-, (15R)- Macbecin I NSC330499
pdb file: 604707.pdb sdf file: 604707.sdf directory: 604707

2-Azabicyclo[16.3.1]docosa-1(22),4,6,10,18,20-hexaen-3-one, 20,22-bis(acetyloxy)-9-[(aminocarbonyl)oxy]-13-hydroxy-8,14,19-trimethoxy-4,10,12,16-tetramethyl- 30562-35-7 AIDS-031135 AIDS031135 Hydrogeldanamycin-18,21-diacetate NSC255108
pdb file: 613787.pdb sdf file: 613787.sdf directory: 613787

17-Aminodemethoxygeldanamycin 2-Azabicyclo[16.3.1]docosa-4,6,10,18,21-pentaene-3,20,22-trione, 19-amino-9-[(aminocarbonyl)oxy]-13-hydroxy-8,14-dimethoxy-4,10,12,16-tetramethyl-, (8R,9R,12R,13S,14R,16R)- 64202-81-9 AIDS-031136 AIDS031136 NSC255109
pdb file: 613788.pdb sdf file: 613788.sdf directory: 613788

2-Azabicyclo[16.3.1]docosa-4,6,10,18,21-pentaene-3,20,22-trione, 9-[(aminocarbonyl)oxy]-19-[(2-chloroethyl)amino]-13-hydroxy-8,14-dimethoxy-4,10,12,16-tetramethyl-, (8R,9R,12R,13R,14R,16R)- 71952-92-6 AIDS-031209 AIDS031209 Geldanamycin Deriv NSC320877
pdb file: 613806.pdb sdf file: 613806.sdf directory: 613806

AIDS-057838 AIDS057838 Angeloylgomisin-R
pdb file: 621976.pdb sdf file: 621976.sdf directory: 621976

70563-58-5 AIDS-071761 AIDS071761 Antibiotic Tan 420F Geldanamycin, 17-demethoxy-15-methoxy-11-O-methyl-, (15R)- Herbimycin Herbimycin A
pdb file: 627034.pdb sdf file: 627034.sdf directory: 627034

10-{(1E)-2-[3-((2Z)But-2-enyl)oxiran-2-yl]vinyl}oxecan-2-one AIDS-094961 AIDS094961 Mainly marine derived natural product Mueggelone
pdb file: 637916.pdb sdf file: 637916.sdf directory: 637916

30562-34-6 AIDS-096125 AIDS096125 Geldanamycin NSC122750
pdb file: 639027.pdb sdf file: 639027.sdf directory: 639027

(5S,11S,1R)-3,7,11-Trimethyl-13-oxa-12-oxobicyclo[8.3.0]trideca-2,6-dien-5-yl (2Z)-2-methylbut-2-enoate AIDS-104099 AIDS104099 Tamaulipin A angelate
pdb file: 641247.pdb sdf file: 641247.sdf directory: 641247

8-alpha-[(4-Acetoxy-5-hydroxy)-angelate]salonitenolide AIDS-104629 AIDS104629
pdb file: 641746.pdb sdf file: 641746.sdf directory: 641746

2H-Furo(2,3-h)(1)benzopyran-2-one, 4-methyl- 4-Methyl-2H-furo(2,3-h)-1-benzopyran-2-one 4-Methylangelicin 5-19-04-00456 (Beilstein Handbook Reference) 6457-92-7 BRN 0174731
pdb file: 657887.pdb sdf file: 657887.sdf directory: 657887

2-Butenoic acid, 2-methyl-, butyl ester, (2Z)- 2-Butenoic acid, 2-methyl-, butyl ester, (Z)- 7785-64-0 Butyl 2-methylcrotonate (Z)- EINECS 232-084-1 n-Butyl angelate
pdb file: 659146.pdb sdf file: 659146.sdf directory: 659146

10482-55-0 2-Butenoic acid, 2-methyl-, 3-methylbutyl ester, (2Z)- 2-Butenoic acid, 2-methyl-, 3-methylbutyl ester, (Z)- EINECS 233-985-2 Isoamyl angelate Isopentyl 2-methylcrotonate (Z)-
pdb file: 659571.pdb sdf file: 659571.sdf directory: 659571

15798-77-3 2H-Furo(2,3-h)(1)benzopyran-2-one, 8-methyl- 2H-Furo(2,3-h)-1-benzopyran-2-one, 8-methyl- 5'-Methylangelicin 8-Methyl-2H-furo(2,3-h)-1-benzopyran-2-one
pdb file: 661966.pdb sdf file: 661966.sdf directory: 661966

22-((2-Methyl-1-oxo-2-butenyl)oxy)-3-oxo-olean-12-en-28-oic acid, (22beta) 22-((2-Methyl-1-oxo-2-butenyl)oxy)-3-oxo-olean-12-en-28-oic acid, 22-beta(Z)- 22-beta-Angeloyloxyoleanolic acid 467-81-2 HSDB 3503 Lantadene A Olean-12-en-28-oic acid, 22-((2-methyl-1-oxo-2-butenyl)oxy)-3-oxo-, (22beta(Z))- Olean-12-en-28-oic acid, 22-beta-hydroxy-3-oxo-, 2-methylcrotonate, (Z)- Olean-12-en-28-oic acid, 22beta-hydroxy-3-oxo-, 2-methylcrotonate, (Z)- Rehmannic acid
pdb file: 668197.pdb sdf file: 668197.sdf directory: 668197

2H-Furo(2,3-h)-1-benzopyran-2-one, 9-methyl- 4'-Methylangelicin 78982-40-8 9-Methylangelicin
pdb file: 669276.pdb sdf file: 669276.sdf directory: 669276

2-Butenoic acid, 2-methyl-, 3-methylpentyl ester, (2Z)- 2-Butenoic acid, 2-methyl-, 3-methylpentyl ester, (Z)- 3-Methylpentyl 2-methylisocrotonate 3-Methylpentyl angelate 53082-58-9 EINECS 258-350-7
pdb file: 681179.pdb sdf file: 681179.sdf directory: 681179

2-Butenoic acid, 2-methyl-, propyl ester, (Z)- 53082-57-8 EINECS 258-349-1 Propyl 2-methylisocrotonate n-Propyl angelate
pdb file: 681821.pdb sdf file: 681821.sdf directory: 681821

37317-08-1 39277-44-6 51731-03-4 8060-79-5 Alucol Aludrox Aluminum hydroxide (Al(OH)3), mixt. with magnesium hydroxide (Mg(OH)2) Aluminum hydroxide - magnesium hydroxide mixt. Aluminum hydroxide, mixt. with magnesium hydroxide Coalgel 60 Delcid Digex Diovol EX Gelcocaine Maalox Maalox 70 Maalox TC Maaloxan Maaloxon Magnesium hydroxide (Mg(OH)2), mixt. with aluminum hydroxide (Al(OH)3) Neogelco Novalucol Regla pH Regla pH (liquid) Riopone Supralox WinGel Winton
pdb file: 682347.pdb sdf file: 682347.sdf directory: 682347

2H-Furo(2,3-h)(1)benzopyran-2-one, 4,6,9-trimethyl, plus ultraviolet A radiation 2H-Furo(2,3-h)-1-benzopyran-2-one, 4,6,9-trimethyl- 4,4',6-Trimethylangelicin 4,4',6-Trimethylangelicin plus ultraviolet A radiation 4,4,6-Trimethylangelicin 4,6,4'-Trimethylangelicin 4,6,9-Trimethyl-2H-furo(2,3-h)(1)benzopyran-2-one plus ultraviolet A radiation 4,6,9-Trimethyl-2H-furo(2,3-h)-1-benzopyran-2-one 4-Hydroxy-beta,3,7-trimethyl-5-benzofuranacrylic acid delta-lactone 90370-29-9 BRN 4467945 CCRIS 4277
pdb file: 684994.pdb sdf file: 684994.sdf directory: 684994

(Carbonato(2-))tetrahydroxydialuminum (mu-(Carbonato(2-)-O:O'))tetrahydroxydialuminum 12538-82-8 Aluminum basic carbonate Aluminum hydroxycarbonate gel Aluminum, (mu-(carbonato(2-)-O:O'))tetrahydroxydi- Basaljel Basic aluminum carbonate gel
pdb file: 685203.pdb sdf file: 685203.sdf directory: 685203

2-Butenoic acid, 2-methyl-, 2-methyl-2-propenyl ester, (2Z)- 2-Butenoic acid, 2-methyl-, 2-methyl-2-propenyl ester, (Z)- 2-Methylallyl 2-methylisocrotonate 61692-78-2 EINECS 262-901-7 Methallyl angelate
pdb file: 686462.pdb sdf file: 686462.sdf directory: 686462

13224-63-0 22beta-Angeloyloxyoleanolic acid Lantadene A (reduced) Olean-12-en-28-oic acid, 3-hydroxy-22-((2-methyl-1-oxo-2-butenyl)oxy)-, (3beta,22beta(Z))- Reduced lantadene A
pdb file: 696107.pdb sdf file: 696107.sdf directory: 696107

9005-91-8 Gelatins, reaction products with glyoxal, oxidized Gelifundol Oxypolygelatin oxypolygelatine
pdb file: 698780.pdb sdf file: 698780.sdf directory: 698780

73341-73-8 C-14919 E-2 Geldanamycin, 18,21-didehydro-6,17-didemethoxy-18,21-dideoxo-18,21-dihydroxy-15-methoxy-6-methyl-11-O-methyl-, (6S,15R)- (9CI) Macbecin II NSC 330500
pdb file: 699366.pdb sdf file: 699366.sdf directory: 699366

3-Methoxy-2-(methylamino)benzoic acid methyl ester 483-64-7 5296-80-0 Benzoic acid, 3-methoxy-2-(methylamino)-, methyl ester Damascenine Nigelline
pdb file: 699625.pdb sdf file: 699625.sdf directory: 699625

91700-92-4 Geldanamycin, 17-demethoxy-15-methoxy-, (15R)- Herbimycin C
pdb file: 701450.pdb sdf file: 701450.sdf directory: 701450

21,22-Darb 21,22-Di-O-angeloyl-R(1)-barrigenol 92948-00-0 Olean-12-ene-3,15,16,21,22,28-hexol, 3-azido-7,12-dihydroxy-N-(2-(2-(iodo-125I)-1H-imidazol-4-yl)ethyl)-, (3beta,15alpha,16alpha,21beta(Z),22alpha(Z))-
pdb file: 701718.pdb sdf file: 701718.sdf directory: 701718

2-Propen-1-one, 1-(3-(3,7-dimethyl-2,6-octadienyl)-2,4-dihydroxyphenyl)-3-(4-hydroxyphenyl)-, (E,E)- 62949-76-2 Xanthoangelol
pdb file: 701719.pdb sdf file: 701719.sdf directory: 701719

96617-52-6 Agd-C Agelasidine C Guanidine, (2-((3,7-dimethyl-9-(1,2,6-trimethyl-2-cyclohexen-1-yl)-2,6-nonadienyl)sulfonyl)ethyl)-, (1S-(1alpha(2E,6E),6beta))-
pdb file: 702731.pdb sdf file: 702731.sdf directory: 702731

14-Hydroxygelsedine 96681-54-8 Gelsedine, 14-hydroxy-
pdb file: 702747.pdb sdf file: 702747.sdf directory: 702747

76207-83-5 Geldanamycin, 17-demethoxy- Herbimycin B
pdb file: 703789.pdb sdf file: 703789.sdf directory: 703789

149471-08-9 1H-Cyclopent(b)anthracen-5,10-dione, 2,10a-dihydro-8,10a-dihydroxy-3,11-dimethyl- 1H-Cyclopent(b)anthracene-5,10-dione, 2,10a-dihydro-8,10a-dihydroxy-3,11-dimethyl- 2,10a-Dihydro-8,10a-dihydroxy-3,11-dimethyl-1H-cyclopent(b)anthracen-5,10-dione 2,10a-Dihydro-8,10a-dihydroxy-3,11-dimethyl-1H-cyclopent(b)anthracene-5,10-dione Kigelinone
pdb file: 704323.pdb sdf file: 704323.sdf directory: 704323

2H-Furo(2,3-h)-1-benzopyran-2-one, 6-methyl- 6-Methylangelicin 90370-14-2
pdb file: 705500.pdb sdf file: 705500.sdf directory: 705500

121880-07-7 Methyl 3-oxo-22-hydroxyolean-12-ene-29-oate Olean-12-en-29-oic acid, 22-hydroxy-3-oxo-, methyl ester, (20alpha,22alpha)- Regelin D
pdb file: 706066.pdb sdf file: 706066.sdf directory: 706066

121880-08-8 Methyl 3,22-dihydroxyurs-12-ene-30-oate Regelindiol A Urs-12-en-30-oic acid, 3,22-dihydroxy-, methyl ester, (3beta,22alpha)-
pdb file: 706067.pdb sdf file: 706067.sdf directory: 706067

109029-03-0 2H-Benzofuro(2,3-h)(1)benzopyran-2-one, 8,9,10,11-tetrahydro-4,6-dimethyl- 8,9,10,11-Tetrahydro-4,6-dimethyl-2H-benzofuro(2,3-h)(1)benzopyran-2-one THBA Tetrahydrobenzo-4,6-dimethylangelicin
pdb file: 707454.pdb sdf file: 707454.sdf directory: 707454

(1R-(1alpha(2E,6E),6beta))-(2-((3-(Hydroxymethyl)-7-methyl-9-(1,2,6-trimethyl-2-cyclohexen-1-yl)-2,6-nonadienyl)sulfonyl)ethyl)guanidine (2-((3-(Hydroxymethyl)-7-methyl-9-(1,2,6-trimethyl-2-cyclohexen-1-yl)-2,6-nonadienyl)sulfonyl)ethyl)guanidine (1R-(1alpha(2E,6E),6beta))- 139680-61-8 Agelasidine D Guanidine, (2-((3-(hydroxymethyl)-7-methyl-9-(1,2,6-trimethyl-2-cyclohexen-1-yl)-2,6-nonadienyl)sulfonyl)ethyl)-, (1R-(1alpha(2E,6E),6beta))-
pdb file: 708609.pdb sdf file: 708609.sdf directory: 708609

142808-37-5 7H-Purinium, 6-amino-7-(5-(5-((((4-bromo-1H-pyrrol-2-yl)carbonyl)oxy)methyl)-1,2,3,4,4a,7,8,8a-octahydro-1,2,4a-trimethyl-1-naphthalenyl)-3-methyl-2-pentenyl)-9-methyl-, (1R-(1alpha(E),2beta,4aalpha,8aalpha))- Agelasine G
pdb file: 708842.pdb sdf file: 708842.sdf directory: 708842

152139-44-1 Agelasphin 11 Agelasphin-11 Agl-11 N-(1-((alpha-D-Galactopyranosyloxy)methyl)-2,3-dihydroxy-15-methylheptadecyl)-2-hydroxytetracosanamide Tetracosanamide, N-(1-((alpha-D-galactopyranosyloxy)methyl)-2,3-dihydroxy-15-methylheptadecyl)-2-hydroxy-
pdb file: 709248.pdb sdf file: 709248.sdf directory: 709248

2,3-Dihydro-2,2-dimethyl-7-(((methylamino)carbonyl)oxy)-3-benzofuranyl-2-methyl-2-butenoate 2-Butenoic acid, 2-methyl-, 2,3-dihydro-2,2-dimethyl-7-(((methylamino)carbonyl)oxy)-3-benzofuranyl ester, (Z)- 3-Hydroxycarbofuran angelate 79189-81-4
pdb file: 709469.pdb sdf file: 709469.sdf directory: 709469

84104-83-6 Methyl 3,22-dihydroxyolean-12-ene-29-oate Olean-12-en-29-oic acid, 3,22-dihydroxy-, methyl ester, (3beta,20alpha,22alpha)- Regelindiol B
pdb file: 710945.pdb sdf file: 710945.sdf directory: 710945

2H-Furo(2,3-h)-1-benzopyran-2-one, 3-chloro-4-(dimethylamino)- 86799-45-3 Dma CA N,N-Dimethyl-4-amino-3-chloroangelicin
pdb file: 712024.pdb sdf file: 712024.sdf directory: 712024

2H-Thieno(2,3-h)-1-benzopyran-2-one, 3-chloro-4-(dimethylamino)- 3-Chloro-4-dimethylaminothioangelicin 90236-91-2 CDATA
pdb file: 723884.pdb sdf file: 723884.sdf directory: 723884

2H-Furo(2,3-h)-1-benzopyran-2-one, 6,8-dimethyl- 6,5'-Dimethylangelicin 6,8-Dimethylangelicin 90370-11-9
pdb file: 723900.pdb sdf file: 723900.sdf directory: 723900

7H-Purinium, 6-amino-9-methyl-7-(3-methyl-5-(1,2,3,4,4a,7,8,8a-octahydro-1,2,4a,5-tetramethyl-1-naphthalenyl)-2-pentenyl)-, (1S-(1alpha(E),2beta,4abeta,8aalpha))- 92664-76-1 Agelasine B Ags-B
pdb file: 724115.pdb sdf file: 724115.sdf directory: 724115

2H-Furo(2,3-h)(1)benzopyran-2-one, 9-aminomethyl-4,8-dimethyl-, hydrochloride 4'-Aminomethyl-4,5'-dimethylangelicin hydrochloride 75663-42-2 9-Aminomethyl-4,8-dimethyl-2H-furo(2,3-h)-1-benzopyran-2-one hydrochloride
pdb file: 727156.pdb sdf file: 727156.sdf directory: 727156

2H-Furo(2,3-h)-1-benzopyran-2-one, 4,8-dimethyl-7-(hydroxymethyl)-, acetate (ester) 4,5'-Dimethyl-4'-acetoxymethylangelicin 4,8-Dimethyl-7-(hydroxymethyl)-2H-furo(2,3-h)-1-benzopyran-2-one acetate (ester) 78560-65-3
pdb file: 727248.pdb sdf file: 727248.sdf directory: 727248

2H-Furo(2,3-h)-1-benzopyran-2-one, 8,9-dimethyl- 4',5'-Dimethylangelicin 78982-41-9
pdb file: 727359.pdb sdf file: 727359.sdf directory: 727359

112308-10-8 2H-Furo(2,3-h)-1-benzopyran-2-one, 6,8,9-trimethyl- 6,4',5'-Trimethylangelicin 6,8,9-Trimethyl-2H-furo(2,3-h)-1-benzopyran-2-one
pdb file: 728091.pdb sdf file: 728091.sdf directory: 728091

17-(Allylamino)-17-demethoxygeldanamycin 17-(Allylamino)geldanamycin 17-Demethoxy-17-allylamino geldanamycin 17AAG 75747-14-7 AAG Cp 127374 Geldanamycin, 17-demethoxy-17-(2-propenylamino)- KOS-953 NSC 330507
pdb file: 728608.pdb sdf file: 728608.sdf directory: 728608

2H-Furo(2,3-h)-1-benzopyran-2-one, 4,8-dimethyl-7-(hydroxymethyl)- 4,5'-Dimethyl-4'-hydroxymethylangelicin 4,8-Dimethyl-7-(hydroxymethyl)-2H-furo(2,3-h)-1-benzopyran-2-one 75663-40-0 BRN 5559690
pdb file: 731165.pdb sdf file: 731165.sdf directory: 731165

71205-22-6 Almasilate [BAN:INN] Almasilato [INN-Spanish] Almasilatum [INN-Latin] Dianeusine Magnesium aluminosilicate (MgAl2Si2O8) hydrate Magnesium aluminosilicate hydrate Malinal Simagel
pdb file: 733453.pdb sdf file: 733453.sdf directory: 733453

2-Butenoic acid, 2-methyl-, 9,10-dihydro-8,8-dimethyl-10-(3-methyl-1-oxobutoxy)-2-oxo-2H,8H-benzo(1,2-b:3,4-b')dipyran-9-yl ester, (9S-(9alpha(Z),10alpha))- 3'-Angeloyl-4'-isovalerylkhellactone 78478-28-1 Praeruptorin E
pdb file: 734348.pdb sdf file: 734348.sdf directory: 734348

2H-Furo(2,3-h)-1-benzopyran-2-one, 4,8-dimethyl-7-((2-(dimethylamino)ethoxy)methyl)- 4,5'-Dimethyl-4'-dimethylaminoethoxymethylangelicin 4,8-Dimethyl-7-((2-(dimethylamino)ethoxy)methyl)-2H-furo(2,3-h)-1-benzopyran-2-one 78560-66-4
pdb file: 734352.pdb sdf file: 734352.sdf directory: 734352

159903-67-0 1H-Indol-5-ol, 2,6-bis(2-amino-1-(6-bromo-1H-indol-3-yl)ethyl)-3-(2-aminoethyl)- 2,6-Bis(2-amino-1-(6-bromo-1H-indol-3-yl)ethyl)-3-(2-aminoethyl)-1H-indol-5-ol Gelliusine A Gelliusine B
pdb file: 735259.pdb sdf file: 735259.sdf directory: 735259

82354-38-9 Gelsedine, 4,20-didehydro- Humantenmine
pdb file: 735653.pdb sdf file: 735653.sdf directory: 735653

151687-86-4 Angelmicin B
pdb file: 735983.pdb sdf file: 735983.sdf directory: 735983

1317-26-6 Aluminum magnesium hydroxide (AlMg2(OH)7), monohydrate Aluminum magnesium hydroxide(AlMg2(OH)7), monohydrate Aluminum magnesium hydroxide, monohydrate Hydrated magnesium aluminum gel Magaldrate Moalium hydrate
pdb file: 736813.pdb sdf file: 736813.sdf directory: 736813

2-Butenoic acid, polymer with ethenyl acetate 25609-89-6 39355-40-3 52624-16-5 55353-15-6 55777-55-4 62046-79-1 70992-32-4 80883-30-3 83138-10-7 Aresil 86-12 CE 5142 Cevian A Cevian A 020 Cevian A 021 Coponyl PK 40 Crotonic acid, polymer with vinyl acetate Emultex alpha 38 Ethenyl acetate, polymer with 2-butenoic acid Gafset S 100 Gelva C 3V20 Gelva C 3V30 Gelva C 5V10 Gelva C 5V16 Luviset CA 66 Mowilith CT 5 National Starch 28-1310 National Starch Resin 28-1310 Resyn 28-1310 VA/Crotonates copolymer Vinac 310 Vinac 516 Vinac ASB 516 Vinamul 6000 Vinyl acetate-crotonic acid copolymer
pdb file: 737473.pdb sdf file: 737473.sdf directory: 737473

1-Hexaminium, N,N,N-trimethyl-6-(2-propenylamino)-, chloride, polymer with (chloromethyl)oxirane, 2-propen-4-amine and N-2-propenyl-1-decanamine, hydrochloride 182815-44-7 CholestaGel Colesevelam hydrochloride GT 31-104 GT 31-104HB GT31-104 Welchol
pdb file: 737513.pdb sdf file: 737513.sdf directory: 737513

2H-1-Benzopyran-6-carboxaldehyde, 7-methoxy-2-oxo- 4444-74-0 6-Formyl-7-methoxycoumarin 7-Methoxy-2-oxo-2H-1-benzopyran-6-carboxaldehyde Angelical Crenulatin
pdb file: 738261.pdb sdf file: 738261.sdf directory: 738261

6029-82-9 7-Angelylretronecine CCRIS 4337
pdb file: 738314.pdb sdf file: 738314.sdf directory: 738314

12-Deoxyphorbol-13-angelate 5H-Cyclopropa(3,4)benz(1,2-e)azulen-5-one, 1,1a-alpha,1b-beta,4,4a,7a-alpha,7b,8,9,9a-decahydro-4a-beta,7b-alpha,9a-alpha-trihydroxy-3-(hydroxymethyl)-1,1,6,8-alpha-tetramethyl-, 9a-(2-methylcrotonate) 65700-60-9
pdb file: 740602.pdb sdf file: 740602.sdf directory: 740602

66220-44-8 AAC AAC (combination) Alginic acid compound Alginic acid, mixt. with aluminum hydroxide, silicic acid (H4Si3O8) magnesium salt (1:2) and sodium hydrogen carbonate Gastrocote Gaviscon Quigel
pdb file: 740618.pdb sdf file: 740618.sdf directory: 740618

67370-02-9 Angeloylzygadenine Cevane-3,4,14,15,16,20-hexol, 4,9-epoxy-, 3-(2-methyl-2-butenoate), (3beta(Z),4alpha,15alpha,16beta)-
pdb file: 740642.pdb sdf file: 740642.sdf directory: 740642

109974-21-2 Methyl 3-oxo-22-hydroxyurs-12-en-30-oic acid Regelin Regelin C Urs-12-en-30-oic acid, 22-hydroxy-3-oxo-, methyl ester, (22alpha)-
pdb file: 741270.pdb sdf file: 741270.sdf directory: 741270

109974-22-3 Methyl 3-oxo-22,23-dihydroxyurs-12-en-30-oic acid Regelinol Urs-12-en-30-oic acid, 22,23-dihydroxy-3-oxo-, methyl ester, (4alpha,22alpha)-
pdb file: 741271.pdb sdf file: 741271.sdf directory: 741271

116988-91-1 2-Butenoic acid, 2-methyl-, 2-hydroxy-1-(((9-methoxy-7-oxo-7H-furo(3,2-g)(1)benzopyran-4-yl)oxy)methyl)-2-methylpropyl ester, (Z)- Isobyakangelicin angelate
pdb file: 741467.pdb sdf file: 741467.sdf directory: 741467

136841-34-4 Tentagel Tentagel resin Tentagel-S
pdb file: 741831.pdb sdf file: 741831.sdf directory: 741831

152751-57-0 182683-00-7 198343-01-0 2-Propen-1-amine, hydrochloride, polymer with (chloromethyl)oxirane Allylamine hydrochloride - epichlorhydrin copolymer Allylamine hydrochloride - epichlorohydrin copolymer GT 16-026A Oxirane, (chloromethyl)-, polymer with 2-propen-1-amine hydrochloride RenaGel Sevelamer Sevelamer hydrochloride
pdb file: 741935.pdb sdf file: 741935.sdf directory: 741935

8065-58-5 Almagel laxans Almagel-neo D-Glucitol, mixt. with aluminum hydroxide and magnesium oxide
pdb file: 743135.pdb sdf file: 743135.sdf directory: 743135

10337-83-4 4,4',5'-Trimethylangelicin 4-Hydroxy-beta,2,3-trimethyl-5-benzofuranacrylic acid gamma-lactone 5-Benzofuranacrylic acid, 4-hydroxy-beta,2,3-trimethyl-, gamma-lactone
pdb file: 743313.pdb sdf file: 743313.sdf directory: 743313

82375-28-8 Gelsedine, 4,20-didehydro-14-hydroxy- Humantendine Humantenidine
pdb file: 751572.pdb sdf file: 751572.sdf directory: 751572

89412-79-3 Anemodeanin A Isolate from Anemone raddeana regel NSC 382873 Olean-12-en-28-oic acid, 3-((O-6-deoxy-alpha-L-mannopyranosyl-(1-2)-O-beta-D-glucopyranosyl-(1-2)-alpha-L-arabinopyranosyl)oxy)-, (3beta)- Oleanolic acid 3-O-alpha-rhamnopyranosyl(1-2)-beta-glucopyranosyl(1-2)-alpha-arabinopyranoside Raddeanin A
pdb file: 752033.pdb sdf file: 752033.sdf directory: 752033

16-Methylenechlormadinone 17-Acetoxy-6-chloro-16-methylene-4,6-pregnadiene-3,20-dione 17alpha-Acetoxy-6-chlor-16-methylen-6-dehydroprogesteron 6-Chlor-17alpha-hydroxy-16-methylen-4,6-pregnadien-3,20-dion 17-acetat 6-Chloro-17-hydroxy-16-methylenepregna-4,6-diene-3,20-dione acetate 6-Chloro-17alpha-hydroxy-16-methylene-4,6-pregnadiene-3,20-dione 17-acetate 6799-23-1 Agelin Chlorsuperlutin Pregna-4,6-diene-3,20-dione, 17-(acetyloxy)-6-chloro-16-methylene- Pregna-4,6-diene-3,20-dione, 6-chloro-17-hydroxy-16-methylene-, acetate Sch 12600
pdb file: 752722.pdb sdf file: 752722.sdf directory: 752722

(-)-Magellanine 1H-Benzo(3a,4)pentaleno(2,1-c)pyridin-1-one, 4,4a,5,6,6a,6b,7,8,9,10,10a,11-dodecahydro-6-hydroxy-3,9-dimethyl-, (4aS,6S,6aR,6bS,10aS,11aS)- 1H-Benzo(3a,4)pentaleno(2,1-c)pyridin-1-one, 4,4a,5,6,6a,6b,7,8,9,10,10a,11-dodecahydro-6-hydroxy-3,9-dimethyl-, (4aS-(4aalpha,6alpha,6abeta,6balpha,10aalpha,11aR*))- 61273-75-4 Magellanine
pdb file: 759638.pdb sdf file: 759638.sdf directory: 759638

108006-56-0 Butanoic acid, 3-methyl-, 2-hydroxy-1-(((4-methoxy-7-oxo-7H-furo(3,2-g)(1)benzopyran-9-yl)oxy)methyl)-2-methylpropyl ester, (R)- Byakangelicin 2'-O-isovalerate
pdb file: 761260.pdb sdf file: 761260.sdf directory: 761260

18550-55-5 Angeli's salt Hyponitric acid Oxyhyponitrite Sodium trioxodinitrate
pdb file: 765830.pdb sdf file: 765830.sdf directory: 765830

8060-72-8 D-Gluconic acid, compd. with N,N''-bis(4-chlorophenyl)-3,12-diimino-2,4,11,13-tetraazatetradecanediimidamide (2:1), mixt. with 2-(diethylamino)-N-(2,6-dimethylphenyl)acetamide monohydrochloride Instillagel
pdb file: 766513.pdb sdf file: 766513.sdf directory: 766513

76095-54-0 Cortalugel 20 Pregna-1,4-diene-3,20-dione, 11,17,21-trihydroxy-, (11beta)-, mixt. with aluminum phosphate (1:1)
pdb file: 769465.pdb sdf file: 769465.sdf directory: 769465

76403-98-0 Benzamide, 5-(aminosulfonyl)-N-((1-ethyl-2-pyrrolidinyl)methyl)-2-methoxy-, mixt. with aluminum oxide hydrate Dogmagel
pdb file: 769487.pdb sdf file: 769487.sdf directory: 769487

2-Butenoic acid, 2-methyl-, 2-(((3-(7-methoxy-1,3-benzodioxol-5-yl)-2-propenyl)oxy)carbonyl)-2-butenyl ester, (Z,Z,?)- 67008-16-6 Anthriscusin O-((Z)-2-Angeloyloxymethyl-2-butenoyl)-3-methoxy-4, 5-methylenedioxycinnamyl alcohol
pdb file: 771589.pdb sdf file: 771589.sdf directory: 771589

109029-05-2 4,6-Dimethylbenzoangelicin
pdb file: 772113.pdb sdf file: 772113.sdf directory: 772113

99232-07-2 Benzeneacetic acid, alpha-(hydroxymethyl)-8-methyl-8-azabicyclo(3.2.1)oct-3-yl ester endo-(+-)-, (E,E)- Gastro-caine Gastrocaine gel
pdb file: 773565.pdb sdf file: 773565.sdf directory: 773565

114216-85-2 4a(2H)-Naphthalenol, 1-(5-(3,6-dihydro-3-methyl-6-(methylimino)-7H-purin-7-yl)-3-methyl-3-pentenyl)octahydro-1,2,5,5-tetramethyl-, (1alpha(3E),2beta,4abeta)-(+)- Agelasimine A
pdb file: 773899.pdb sdf file: 773899.sdf directory: 773899

114216-87-4 4a(2H)-Naphthalenol, octahydro-1,2,5,5-tetramethyl-1-(3-methyl-5-(1,2,3,6-tetrahydro-6-imino-1,3-dimethyl-7H-purin-7-yl)-3-pentenyl)-, (1alpha(3E),2beta,4abeta)-(+)- Agelasimine B
pdb file: 773900.pdb sdf file: 773900.sdf directory: 773900

12-Deoxyphorbol-13-angelate-20-acetate 5H-Cyclopropa(3,4)benz(1,2-e)azulen-5-one, 1,1a-beta,1b-alpha,4,4a,7a-beta,7b,8,9,9a-decahydro-4a-alpha,7b-beta,9a-beta-trihydroxy-3-acetoxymethyl-1,1,6,8-beta-tetramethyl-, 9-((Z)-2-methylbutenate) 65700-59-6
pdb file: 775624.pdb sdf file: 775624.sdf directory: 775624

11029-70-2 Antibiotic obtained from cultures of Actinomyces flavochromogenes var. heliomycini or the same substance obtained by any other means Geliomitsin Heliomicina [INN-Spanish] Heliomycin Heliomycin [INN] Heliomycine [INN-French] Heliomycinum [INN-Latin]
pdb file: 789457.pdb sdf file: 789457.sdf directory: 789457
|